"FASTKD5" Related Products

Recombinant Human FASTKD5, His-tagged

Cat.No.: FASTKD5-81H
Product Overview: Recombinant Human FAST Kinase Domain-Containing Protein 5/FASTKD5 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Leu764) of Human FASTKD5 fused with a polyhistidine tag at the C-terminus.
Description: FAST kinase domain-containing protein 5,also known as FAKD5,FAST kinase domains 5 and FASTKD5, is a member of the FAST kinase family. FASTKD5 is a mitochondrion component and contains one RAP domain.FASTKD5 has an protein kinase activity. FASTKD5 is involved in cellular respiration .Recombination human FASTKD5 is encoded by 764AA and the mature peptide is expressed from Met1 to Leu764 with a his tag at the C terminal.
Source: HEK293
Species: Human
Tag: His
AA Sequence: MAATLKSLKLVRYRAFCSPSAFGAVRSVSYWNVSSTQHGGQDPPEHISLCHSAKKVKNIC STFS SRRILTTSSAHPGLEFSKTSSSKASTLQLGSPRATGVDEEDVEVFDSFENMRVFLQ LRPEYRVH SYNASETSQLLSVSEGELILHKVRVNQNNLQAQVIVDYLCKLSSLPAEQHPV LLGSTSFALLCQ LSVKKIQLFDTQDLINVLKAFVILGIPHSHSMLDVYETKCCHQVWEMN MDQLLLVADLWRYLGR KVPRFLNIFSSYLNLHWKDLSLSQLVHLIYVIGENRQVSQDLMQ KLESLILKYIDLINLEEVGT ICLGFFKSSTNLSEFVMRKIGDLACANIQHLSSRSLVNIV KMFRFTHVDHINFMKQIGEIAPQR IPSLGVQGVMHLTLYCSALRFLNEGVMNAVAASLPP RVAHCRSKDVAKILWSFGTLNYKPPNAE EFYSSLISEIHRKMPEFNQYPEHLPTCLLGLA FLEYFPVELIDFALSPGFVRLAQERTKFDLLK ELYTLDGTVGIECPDYRGNRLSTHLQQE GSELLWYLAEKDMNSKPEFLETVFLLETMLGGPQYV KHHMILPHTRSSDLEVQLDVNLKP LPFNREATPAENVAKLRLEHVGVSLTDDLMNKLLKGKARG HFQGKTESEPGQQPMELENK AAVPLGGFLCNVADKSGAMEMAGLCPAACMQTPRMKLAVQFTNR NQYCYGSRDLLGLHNM KRRQLARLGYRVVELSYWEWLPLLKRTRLEKLAFLHEKVFTSALVDHH HHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name: FASTKD5 FAST kinase domains 5 [ Homo sapiens ]
Official Symbol: FASTKD5
Synonyms: FASTKD5; FAST kinase domains 5; FAST kinase domain-containing protein 5; FLJ13149; dJ1187M17.5; FLJ58294;
Gene ID: 60493
mRNA Refseq: NM_021826
Protein Refseq: NP_068598
MIM: 614272
UniProt ID: Q7L8L6
Chromosome Location: 20p13
Function: protein kinase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.