"GFOD1" Related Products

Expand

Recombinant Human GFOD1, His-tagged

Cat.No.: GFOD1-91H
Product Overview: Recombinant Human Glucose-Fructose Oxidoreductase Domain-Containing Protein 1/GFOD1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Lys22-Cys390) of Human GFOD1 fused with a polyhistidine tag at the C-terminus.
Description: Glucose-Fructose Oxidoreductase Domain-Containing Protein 1 (GFOD1) is a member of the Gfo/Idh/MocA family. GFOD1 is a secreted protein and localizes to the extracellular region. GFOD1 has three spliced transcript isoforms. GFOD1 molecular has the nucleotide binding activity and oxidoreductase activity.
Source: HEK293
Species: Human
Tag: His
AA Sequence: KDEGFAVKALWGRTQEEAEELAKEMSVPFYTSRIDEVLLHQDVDLVCINLPPPLTRQIAVKTLGI GKNVICDRTATPLDAFRMTSAAHYYPKLMSIMGNVLRFLPAFVRMKQLIEEGYVGEPLVCEVQVH GGSLLGKKYNWSCDDLMGGGGLHSVGTYIIDLLTFLTGQKAVKVHGLLKTFVKQTDHIKGIRQIT SDDFCTFQMVLEGGVCCTVTLNFNVPGEFKQDVTVVGSAGRLLAVGTDLYGQRNSAPEQELLVQD ATPVSNSLLPEKAFSDIPSPYLRGTIKMMQAVRQAFQDQDDRRTWDGRPLTMAATFDDCLYALCV VDTIKRSSQTGEWQNIAIMTEEPELSPAYLISEAMRRSRMSLYCVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name: GFOD1 glucose-fructose oxidoreductase domain containing 1 [ Homo sapiens ]
Official Symbol: GFOD1
Synonyms: GFOD1; glucose-fructose oxidoreductase domain containing 1; C6orf114, chromosome 6 open reading frame 114; glucose-fructose oxidoreductase domain-containing protein 1; ADG 90; FLJ20330; ADG-90; C6orf114; FLJ30569; MGC70653; RP11-501I19.1;
Gene ID: 54438
mRNA Refseq: NM_001242628
Protein Refseq: NP_001229557
UniProt ID: Q9NXC2
Chromosome Location: 6pter-p22.1
Function: nucleotide binding; oxidoreductase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.