Recombinant Human COLGALT2, His-tagged COLGALT2-93H

Recombinant Human COLGALT2, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human COLGALT2, His-tagged

Recombinant Human COLGALT2, His-tagged

COLGALT2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : COLGALT2-93H
Product Overview : Recombinant Human Glycosyltransferase 25 Family Member 2/GLT25D2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Leu626) of Human GLT25D2 fused with a polyhistidine tag at the C-terminus.
Description : Glycosyltransferase 25 Family Member 2 (GLT25D2) belongs to the Glycosyltransferase 25 family. GLT25D2 is expressed in brain and skeletal muscle, and it localizes to the Endoplasmic Reticulum lumen. GLT25D2 has a strong β-Galactosyltransferase activity toward various types of Collagen, but it does not have Glucosyltransferase activity. It transfers β-Galactose to Hydroxylysine residues on collagen.
Source : HEK293
Species : Human
Tag : His
AA Sequence : RFVAERDSEDDGEEPVVFPESPLQSPTVLVAVL ARNAAHTLPHFLGCLERLDYPKSRMAIWAAT DHNVDNTTEIFREWLKNVQRLYHYVEWRP MDEPESYPDEIGPKHWPTSRFAHVMKLRQAALRTA REKWSDYILFIDVDNFLTNPQTLNL LIAENKTIVAPMLESRGLYSNFWCGITPKGFYKRTPDYV QIREWKRTGCFPVPMVHSTFL IDLRKEASDKLTFYPPHQDYTWTFDDIIVFAFSSRQAGIQMYL CNREHYGYLPIPLKPHQ TLQEDIENLIHVQIEAMIDRPPMEPSQYVSVVPKYPDKMGFDEIFMI NLKRRKDRRDRML RTLYEQEIEVKIVEAVDGKALNTSQLKALNIEMLPGYRDPYSSRPLTRGEI GCFLSHYSV WKEVIDRELEKTLVIEDDVRFEHQFKKKLMKLMDNIDQAQLDWELIYIGRKRMQV KEPEK AVPNVANLVEADYSYWTLGYVISLEGAQKLVGANPFGKMLPVDEFLPVMYNKHPVAE YKE YYESRDLKAFSAEPLLIYPTHYTGQPGYLSDTETSTIWDNETVATDWDRTHAWKSRKQSR IYSNAKNTEALPPPTSLDTVPSRDEL
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy