Recombinant Human GZMM, His-tagged

Cat.No. : GZMM-97H
Product Overview : Recombinant Human Granzyme M/GZMM is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Thr24-Ala257) of Human GZMM fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 24-257 a.a.
Description : Granzyme M is a secreted protein that belongs to the peptidase S1 family of Granzyme subfamily. Human natural killer (NK) cells and activated lymphocytes express and store a distinct subset of neutral serine proteases together with proteoglycans and other immune effector molecules in large cytoplasmic granules. These serine proteases are collectively termed granzymes and include 4 distinct gene products: Granzyme A, Granzyme B, Granzyme H, and Granzyme M. Granzyme M contains one peptidase S1 domain and is highly, constitutively expressed in activated natural killer (NK) cells. Granzyme M cleaves peptide substrates after methionine, leucine, and norleucine. Its physiological substrates include EZR, α-tubulins and the apoptosis inhibitor BIRC5/Survivin. Granzyme M promotes caspase activation and subsequent apoptosis of target cells.
AA Sequence : TQIIGGREVIPHSRPYMASLQRNGSHLCGGVLVHPKWVLTAAHCLAQRMAQLRLVLGLHTLDSPG LTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQVVAAGTRCSMAGWGLT HQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCLAADSKDQAPCKGDSGGPLVCGKGRV LAGVLSFSSRVCTDIFKPPVATAVAPYVSWIRKVTGRSAVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name GZMM granzyme M (lymphocyte met-ase 1) [ Homo sapiens ]
Official Symbol GZMM
Synonyms GZMM; granzyme M (lymphocyte met-ase 1); granzyme M; LMET1; lymphocyte met ase 1; MET1; met-ase; HU-Met-1; lymphocyte met-ase 1; Met-1 serine protease; natural killer cell granular protease;
Gene ID 3004
mRNA Refseq NM_005317
Protein Refseq NP_005308
MIM 600311
UniProt ID P51124
Chromosome Location 19p13.3
Function peptidase activity; serine-type endopeptidase activity; serine-type peptidase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GZMM Products

Required fields are marked with *

My Review for All GZMM Products

Required fields are marked with *

0
cart-icon
0
compare icon