Recombinant Human GZMM, His-tagged

• Cat.No.: GZMM-97H
• Product Overview: Recombinant Human Granzyme M/GZMM is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Thr24-Ala257) of Human GZMM fused with a polyhistidine tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 24-257 a.a.
• Description: Granzyme M is a secreted protein that belongs to the peptidase S1 family of Granzyme subfamily. Human natural killer (NK) cells and activated lymphocytes express and store a distinct subset of neutral serine proteases together with proteoglycans and other immune effector molecules in large cytoplasmic granules. These serine proteases are collectively termed granzymes and include 4 distinct gene products: Granzyme A, Granzyme B, Granzyme H, and Granzyme M. Granzyme M contains one peptidase S1 domain and is highly, constitutively expressed in activated natural killer (NK) cells. Granzyme M cleaves peptide substrates after methionine, leucine, and norleucine. Its physiological substrates include EZR, α-tubulins and the apoptosis inhibitor BIRC5/Survivin. Granzyme M promotes caspase activation and subsequent apoptosis of target cells.
• AA Sequence: TQIIGGREVIPHSRPYMASLQRNGSHLCGGVLVHPKWVLTAAHCLAQRMAQLRLVLGLHTLDSPG LTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQVVAAGTRCSMAGWGLT HQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCLAADSKDQAPCKGDSGGPLVCGKGRV LAGVLSFSSRVCTDIFKPPVATAVAPYVSWIRKVTGRSAVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.

Gene Information

• Gene Name: GZMM granzyme M (lymphocyte met-ase 1) [ Homo sapiens ]
• Official Symbol: GZMM
• Synonyms: GZMM; granzyme M (lymphocyte met-ase 1); granzyme M; LMET1; lymphocyte met ase 1; MET1; met-ase; HU-Met-1; lymphocyte met-ase 1; Met-1 serine protease; natural killer cell granular protease
• Gene ID: 3004
• mRNA Refseq: NM_005317
• Protein Refseq: NP_005308
• MIM: 600311
• UniProt ID: P51124
• Chromosome Location: 19p13.3
• Function: peptidase activity; serine-type endopeptidase activity; serine-type peptidase activity