"GZMM" Related Products

Expand

Recombinant Human GZMM, His-tagged

Cat.No.: GZMM-97H
Product Overview: Recombinant Human Granzyme M/GZMM is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Thr24-Ala257) of Human GZMM fused with a polyhistidine tag at the C-terminus.
Description: Granzyme M is a secreted protein that belongs to the peptidase S1 family of Granzyme subfamily. Human natural killer (NK) cells and activated lymphocytes express and store a distinct subset of neutral serine proteases together with proteoglycans and other immune effector molecules in large cytoplasmic granules. These serine proteases are collectively termed granzymes and include 4 distinct gene products: Granzyme A, Granzyme B, Granzyme H, and Granzyme M. Granzyme M contains one peptidase S1 domain and is highly, constitutively expressed in activated natural killer (NK) cells. Granzyme M cleaves peptide substrates after methionine, leucine, and norleucine. Its physiological substrates include EZR, α-tubulins and the apoptosis inhibitor BIRC5/Survivin. Granzyme M promotes caspase activation and subsequent apoptosis of target cells.
Source: HEK293
Species: Human
Tag: His
AA Sequence: TQIIGGREVIPHSRPYMASLQRNGSHLCGGVLVHPKWVLTAAHCLAQRMAQLRLVLGLHTLDSPG LTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQVVAAGTRCSMAGWGLT HQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCLAADSKDQAPCKGDSGGPLVCGKGRV LAGVLSFSSRVCTDIFKPPVATAVAPYVSWIRKVTGRSAVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name: GZMM granzyme M (lymphocyte met-ase 1) [ Homo sapiens ]
Official Symbol: GZMM
Synonyms: GZMM; granzyme M (lymphocyte met-ase 1); granzyme M; LMET1; lymphocyte met ase 1; MET1; met-ase; HU-Met-1; lymphocyte met-ase 1; Met-1 serine protease; natural killer cell granular protease;
Gene ID: 3004
mRNA Refseq: NM_005317
Protein Refseq: NP_005308
MIM: 600311
UniProt ID: P51124
Chromosome Location: 19p13.3
Function: peptidase activity; serine-type endopeptidase activity; serine-type peptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.