"LILRB2" Related Products

Expand
Expand

Recombinant Human LILRB2, His-tagged

Cat.No.: LILRB2-115H
Product Overview: Recombinant Human Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 2/LILRB2 produced by transfected human cells is a secreted protein with sequence (Gln22-His458) of Human LILRB2 fused with a polyhistidine tag at the C-terminus.
Description: Members of the immunoglobulin-like transcript (ILT) family are activating and inhibitory immunoreceptors whose genes are located same locus that encodes killer cell Ig-like receptors (KIR). Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 2 (LIR-2) is a type I transmembrane protein. LIR-2 is expressed primarily on monocytes and dendritic cells (DC). Human LIR-2 is produced as a 598 amino acino acid precursor including a 21 aa signal sequence, a 440 aa extracellular domain (ECD), a 21 aa transmenbrane segment, and a 116 aa cytoplasmic domain. LIR-2 binds to Classical MHCI proteins. Ligation of LIR-2 incluces Tyr phosphorylation within its cytoplasmic ITIMs, a requirement for association with SHP-1. LIR-2 mediates tolerogenic DC-induced CD4+ T cell energy in vitro and in vivo.
Source: HEK293
Species: Human
Tag: His
Form: Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
AA Sequence: QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIP SITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFG GFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLEL LVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANF TLGPVSRSYGGQYRCYGAYNLSSEWSAPSDPLDILITGQIHGTPFISVQPGPTVASGENVTLLCQ SWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPS EPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRHVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at
Reconstitution: Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name: LILRB2 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2 [ Homo sapiens ]
Official Symbol: LILRB2
Synonyms: LILRB2; leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2; leukocyte immunoglobulin-like receptor subfamily B member 2; CD85d; ILT4; LIR 2; LIR2; MIR 10; MIR10; ILT-4; Ig-like transcript 4; immunoglobulin-like transcript 4; CD85 antigen-like family member D; leukocyte immunoglobulin-like receptor 2; monocyte/macrophage immunoglobulin-like receptor 10; leukocyte immunoglobulin-like receptor subfamily B member 2 soluble isoform; eukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 6; CD85D; LIR-2; LILRA6; MIR-10;
Gene ID: 10288
mRNA Refseq: NM_001080978
Protein Refseq: NP_001074447
MIM: 604815
UniProt ID: Q8N423
Chromosome Location: 19q13.4
Pathway: Adaptive Immune System, organism-specific biosystem; Immune System, organism-specific biosystem; Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell, organism-specific biosystem; Osteoclast differentiation, organism-specific biosystem; Osteoclast differentiation, conserved biosystem;
Function: MHC class I protein binding; MHC class I protein binding; MHC class Ib protein binding; cell adhesion molecule binding; eukaryotic cell surface binding; inhibitory MHC class I receptor activity; inhibitory MHC class I receptor activity; protein binding; protein phosphatase 1 binding; receptor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.