"LGALSL" Related Products

Expand

Recombinant Human LGALSL, His-tagged

Cat.No.: LGALSL-126H
Product Overview: Recombinant Human Galectin-Related Protein/LGALSL is produced with our E. coli expression system. The target protein is expressed with sequence (Ala2-Ser172) of Human LGALSL fused with a 6His tag at the C-terminus.
Description: Galectin-Related Protein (LGALSL) is a 172 amino acid protein that contains one Galectin domain. LGALSL does not appear to bind carbohydrates or lactose as the critical residues required for binding are not conserved. LGALSL may play a significant role in stimulating smooth muscle growth in developing alveolar wall vessels and the development of pulmonary capillaries.
Source: E. coli
Species: Human
Tag: His
Form: Supplied as a 0.2 μM filtered solution of 20mM Tris, 100mM NaCl, pH 8.0
AA Sequence: MAGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPE SFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILC EHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLGLEHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Store at Please minimize freeze-thaw cycles.

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.