Recombinant Human LGALSL, His-tagged

Cat.No. : LGALSL-126H
Product Overview : Recombinant Human Galectin-Related Protein/LGALSL is produced with our E. coli expression system. The target protein is expressed with sequence (Ala2-Ser172) of Human LGALSL fused with a 6His tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 2-172 a.a.
Description : Galectin-Related Protein (LGALSL) is a 172 amino acid protein that contains one Galectin domain. LGALSL does not appear to bind carbohydrates or lactose as the critical residues required for binding are not conserved. LGALSL may play a significant role in stimulating smooth muscle growth in developing alveolar wall vessels and the development of pulmonary capillaries.
Form : Supplied as a 0.2 μM filtered solution of 20mM Tris, 100mM NaCl, pH 8.0
AA Sequence : MAGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPE SFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILC EHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLGLEHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Store at Please minimize freeze-thaw cycles.

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LGALSL Products

Required fields are marked with *

My Review for All LGALSL Products

Required fields are marked with *

0
cart-icon