Recombinant Human LGALSL, His-tagged
Cat.No. : | LGALSL-126H |
Product Overview : | Recombinant Human Galectin-Related Protein/LGALSL is produced with our E. coli expression system. The target protein is expressed with sequence (Ala2-Ser172) of Human LGALSL fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 2-172 a.a. |
Description : | Galectin-Related Protein (LGALSL) is a 172 amino acid protein that contains one Galectin domain. LGALSL does not appear to bind carbohydrates or lactose as the critical residues required for binding are not conserved. LGALSL may play a significant role in stimulating smooth muscle growth in developing alveolar wall vessels and the development of pulmonary capillaries. |
Form : | Supplied as a 0.2 μM filtered solution of 20mM Tris, 100mM NaCl, pH 8.0 |
AA Sequence : | MAGSVADSDAVVKLDDGHLNNSLSSPVQADVYFPRLIVPFCGHIKGGMRPGKKVLVMGIVDLNPE SFAISLTCGDSEDPPADVAIELKAVFTDRQLLRNSCISGERGEEQSAIPYFPFIPDQPFRVEILC EHPRFRVFVDGHQLFDFYHRIQTLSAIDTIKINGDLQITKLGLEHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Store at Please minimize freeze-thaw cycles. |
◆ Recombinant Proteins | ||
LGALSL-3352H | Recombinant Human LGALSL Protein, His (Fc)-Avi-tagged | +Inquiry |
Lgalsl-3777M | Recombinant Mouse Lgalsl Protein, Myc/DDK-tagged | +Inquiry |
LGALSL-7537H | Recombinant Human LGALSL, His-tagged | +Inquiry |
LGALSL-1834C | Recombinant Chicken LGALSL | +Inquiry |
LGALSL-5268H | Recombinant Human LGALSL Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LGALSL-824HCL | Recombinant Human LGALSL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LGALSL Products
Required fields are marked with *
My Review for All LGALSL Products
Required fields are marked with *
0
Inquiry Basket