Recombinant Human LYZL6, His-tagged
Cat.No. : |
LYZL6-134H |
Product Overview : |
Recombinant Human Lysozyme-Like Protein 6/LYZL6 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser20-Arg148) of Human LYZL6 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
Description : |
Lysozyme-Like Protein 6 (LYZL6) is a member of the C-type lysozyme/α-lactalbumin family. Proteins of this family are bacteriolytic factors that play a role in host defense, whereas α-lactalbumins mediate lactose biosynthesis. LYZL6 is a secreted protein and expressed in the testis and epididymis. LYZL6 contains catalytic residues characteristic of C-type lysozymes and may play a role in male reproduction. Lysozyme-like protein 6 can hydrolyze the (1->4)-β-linkages between N-Acetylmuramic Acid and N-Acetyl-D-Glucosamine residues in a peptidoglycan and between N-Acetyl-D-Glucosamine residues in Chitodextrins. |
Source : |
HEK293 |
Species : |
Human |
Tag : |
His |
AA Sequence : |
SLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNIS KINENADGSFDYGLFQINSHYWC NDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGA RGMNNWVEWRLHCSGRPLFYWLTGCRL RVDHHHHHH |
Endotoxin : |
Less than 0.1 ng/μg (1 IEU/μg). |
Purity : |
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.