Recombinant Human LYZL6, His-tagged
Cat.No. : | LYZL6-134H |
Product Overview : | Recombinant Human Lysozyme-Like Protein 6/LYZL6 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser20-Arg148) of Human LYZL6 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 20-148 a.a. |
Description : | Lysozyme-Like Protein 6 (LYZL6) is a member of the C-type lysozyme/α-lactalbumin family. Proteins of this family are bacteriolytic factors that play a role in host defense, whereas α-lactalbumins mediate lactose biosynthesis. LYZL6 is a secreted protein and expressed in the testis and epididymis. LYZL6 contains catalytic residues characteristic of C-type lysozymes and may play a role in male reproduction. Lysozyme-like protein 6 can hydrolyze the (1->4)-β-linkages between N-Acetylmuramic Acid and N-Acetyl-D-Glucosamine residues in a peptidoglycan and between N-Acetyl-D-Glucosamine residues in Chitodextrins. |
AA Sequence : | SLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNIS KINENADGSFDYGLFQINSHYWC NDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGA RGMNNWVEWRLHCSGRPLFYWLTGCRL RVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
◆ Recombinant Proteins | ||
LYZL6-3970H | Recombinant Human LYZL6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LYZL6-2434R | Recombinant Rhesus Macaque LYZL6 Protein, His (Fc)-Avi-tagged | +Inquiry |
LYZL6-2614R | Recombinant Rhesus monkey LYZL6 Protein, His-tagged | +Inquiry |
LYZL6-134H | Recombinant Human LYZL6, His-tagged | +Inquiry |
LYZL6-6045HF | Recombinant Full Length Human LYZL6 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LYZL6-4577HCL | Recombinant Human LYZL6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYZL6 Products
Required fields are marked with *
My Review for All LYZL6 Products
Required fields are marked with *