"LYZL6" Related Products

Recombinant Human LYZL6, His-tagged

Cat.No.: LYZL6-134H
Product Overview: Recombinant Human Lysozyme-Like Protein 6/LYZL6 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser20-Arg148) of Human LYZL6 fused with a polyhistidine tag at the C-terminus.
Description: Lysozyme-Like Protein 6 (LYZL6) is a member of the C-type lysozyme/α-lactalbumin family. Proteins of this family are bacteriolytic factors that play a role in host defense, whereas α-lactalbumins mediate lactose biosynthesis. LYZL6 is a secreted protein and expressed in the testis and epididymis. LYZL6 contains catalytic residues characteristic of C-type lysozymes and may play a role in male reproduction. Lysozyme-like protein 6 can hydrolyze the (1->4)-β-linkages between N-Acetylmuramic Acid and N-Acetyl-D-Glucosamine residues in a peptidoglycan and between N-Acetyl-D-Glucosamine residues in Chitodextrins.
Source: HEK293
Species: Human
Tag: His
AA Sequence: SLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNIS KINENADGSFDYGLFQINSHYWC NDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGA RGMNNWVEWRLHCSGRPLFYWLTGCRL RVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.