Recombinant Human LYZL6 protein, His-tagged
| Cat.No. : | LYZL6-3876H |
| Product Overview : | Recombinant Human LYZL6 protein(1-148 aa), fused to His tag, was expressed in E. coli. |
| Availability | September 04, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-148 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
| AA Sequence : | MTKALLIYLVSSFLALNQASLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNISKINENADGSFDYGLFQINSHYWCNDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGARGMNNWVEWRLHCSGRPLFYWLTGCRLR |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | LYZL6 lysozyme-like 6 [ Homo sapiens ] |
| Official Symbol | LYZL6 |
| Synonyms | LYC1; UNQ754; PRO1485; TKAL754 |
| Gene ID | 57151 |
| mRNA Refseq | NM_020426.2 |
| Protein Refseq | NP_065159.1 |
| MIM | 612751 |
| UniProt ID | O75951 |
| ◆ Recombinant Proteins | ||
| Lyzl6-3884M | Recombinant Mouse Lyzl6 Protein, Myc/DDK-tagged | +Inquiry |
| LYZL6-134H | Recombinant Human LYZL6, His-tagged | +Inquiry |
| LYZL6-6045HF | Recombinant Full Length Human LYZL6 Protein, GST-tagged | +Inquiry |
| LYZL6-3970H | Recombinant Human LYZL6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| LYZL6-2614R | Recombinant Rhesus monkey LYZL6 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LYZL6-4577HCL | Recombinant Human LYZL6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYZL6 Products
Required fields are marked with *
My Review for All LYZL6 Products
Required fields are marked with *
