Recombinant Human LYZL6, His-tagged
| Cat.No. : | LYZL6-134H |
| Product Overview : | Recombinant Human Lysozyme-Like Protein 6/LYZL6 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser20-Arg148) of Human LYZL6 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 20-148 a.a. |
| Description : | Lysozyme-Like Protein 6 (LYZL6) is a member of the C-type lysozyme/α-lactalbumin family. Proteins of this family are bacteriolytic factors that play a role in host defense, whereas α-lactalbumins mediate lactose biosynthesis. LYZL6 is a secreted protein and expressed in the testis and epididymis. LYZL6 contains catalytic residues characteristic of C-type lysozymes and may play a role in male reproduction. Lysozyme-like protein 6 can hydrolyze the (1->4)-β-linkages between N-Acetylmuramic Acid and N-Acetyl-D-Glucosamine residues in a peptidoglycan and between N-Acetyl-D-Glucosamine residues in Chitodextrins. |
| AA Sequence : | SLISRCDLAQVLQLEDLDGFEGYSLSDWLCLAFVESKFNIS KINENADGSFDYGLFQINSHYWC NDYKSYSENLCHVDCQDLLNPNLLAGIHCAKRIVSGA RGMNNWVEWRLHCSGRPLFYWLTGCRL RVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
| ◆ Recombinant Proteins | ||
| LYZL6-4528H | Recombinant Human LYZL6 Protein, GST-tagged | +Inquiry |
| LYZL6-6045HF | Recombinant Full Length Human LYZL6 Protein, GST-tagged | +Inquiry |
| Lyzl6-3884M | Recombinant Mouse Lyzl6 Protein, Myc/DDK-tagged | +Inquiry |
| LYZL6-2614R | Recombinant Rhesus monkey LYZL6 Protein, His-tagged | +Inquiry |
| LYZL6-134H | Recombinant Human LYZL6, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LYZL6-4577HCL | Recombinant Human LYZL6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LYZL6 Products
Required fields are marked with *
My Review for All LYZL6 Products
Required fields are marked with *




