"METAP1D" Related Products

Expand

Recombinant Human METAP1D, His-tagged

Cat.No.: METAP1D-139H
Product Overview: Recombinant Human Methionine Aminopeptidase 1D Mitochondrial/METAP1D is produced with our E. coli expression system. The target protein is expressed with sequence (Arg44-Ala335) of Human METAP1D fused with a 6His tag at both the N-terminus and C-terminus.
Description: Methionine Aminopeptidase 1D (METAP1D) is a mitochondrion protein that belongs to the peptidase M24A family. METAP1D is overexpressed at the protein level in colon cancer cell lines and colon tumors as compared to normal tissues. N-terminal methionine removal is an important cellular process required for proper biological activity, subcellular localization, and eventual degradation of many proteins. METAP1D is also active with zinc, manganese or divalent ions. It may also play an important role in colon tumorigenesis.
Source: E. coli
Species: Human
Tag: His
Form: Supplied as a 0.2 μM filtered solution of 50mM Tris, 100mM NaCl, pH 8.0
AA Sequence: MGSSHHHHHHSSGLVPRGSHMRQRDISHSIVLPAAVSSAHPVPKHIKKPDYVTTGIVPDWGDSIE VKNEDQIQGLHQACQLARHVLLLAGKSLKVDMTTEEIDALVHREIISHNAYPSPLGYGGFPKSVC TSVNNVLCHGIPDSRPLQDGDIINIDVTVYYNGYHGDTSETFLVGNVDECGKKLVEVARRCRDEA IAACRAGAPFSVIGNTISHITHQNGFQVCPHFVGHGIGSYFHGHPEIWHHANDSDLPMEEGMAFT IEPIITEGSPEFKVLEDAWTVVSLDNQRSAQFEHTVLITSRGAQILTKLPHEALEHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage: Store at Please minimize freeze-thaw cycles.
Gene Name: METAP1D methionyl aminopeptidase type 1D (mitochondrial) [ Homo sapiens ]
Official Symbol: METAP1D
Synonyms: METAP1D; methionyl aminopeptidase type 1D (mitochondrial); methionine aminopeptidase 1D, mitochondrial; MAP1D; Metap1l; methionine aminopeptidase 1D; CDS of metAP-3 within PCR fragment; methionyl aminopeptidase type 1D, mitochondrial;
Gene ID: 254042
mRNA Refseq: NM_199227
Protein Refseq: NP_954697
MIM: 610267
UniProt ID: Q6UB28
Chromosome Location: 2q31.1
Function: aminopeptidase activity; metal ion binding; metalloexopeptidase activity; peptidase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.