Recombinant Human MIIP, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human MIIP, His-tagged

Recombinant Human MIIP, His-tagged

MIIP Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : MIIP-141H
Product Overview : Recombinant Human Migration and Invasion-Inhibitory Protein/MIIP is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Pro388) of Human MIIP fused with a polyhistidine tag at the C-terminus.
Description : Migration and Invasion-Inhibitory Protein (MIIP) was initially discovered in a yeast two-hybrid screen for proteins that interact with and inhibit the migration and invasion-promoting protein insulin-like growth factor binding protein 2 (IGFBP2). It is reported that MIIP not only modulates IGFBP2 but also regulates microtubule by binding to and inhibiting HDAC6, a class 2 histone deacetylase that deacetylates α-tubulin, heat-shock protein 90 (HSP90), and cortactin. In addition, MIIP also regulates the mitosis checkpoint, another microtubule-associated process.
Source : HEK293
Species : Human
Tag : His
AA Sequence : MVEAEELAQLRLLNLELLRQLWVGQDAVRRSVARAASESSLESSSSYNSETPSTPETSSTSLSTS CPRGRSSVWGPPDACRGDLRDVARSGVASLPPANCQHQESLGRPRPHSAPSLGTSSLRDPEPSGR LGDPGPQEAQTSRSILAQQSKLSKPRVTFSEESAVPERSWRLRPYLGYDWIAGSLDTSSSITSQP EAFFSKLQEFRETNKEECICSHPEPQLPGLRESSGSGVEEDHECVYCYRVNRRLFPVPVDPGTPC RLCRTPRDQQGPGTLAQPAHVRVSIPLSILEPPHRYHIHRRKSFDASDTLALPRHCLLGWDIFPP KSEKSSAPRNLDLWSSVSAEAQHQKLSGTSSPFHPASPMQMLPPTPTWSVPQVPRPHVPRQKPVD HHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name : MIIP migration and invasion inhibitory protein [ Homo sapiens ]
Official Symbol : MIIP
Synonyms : MIIP; migration and invasion inhibitory protein; migration and invasion-inhibitory protein; FLJ12438; IIp45; invasion inhibitory protein 45; IGFBP2-binding protein; invasion-inhibitory protein 45; IIP45; RP5-1077B9.4; FLJ38609;
Gene ID : 60672
mRNA Refseq : NM_021933
Protein Refseq : NP_068752
MIM : 608772
UniProt ID : Q5JXC2
Chromosome Location : 1p36.22

Online Inquiry


  •  
  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved.