"MIIP" Related Products

Recombinant Human MIIP, His-tagged

Cat.No.: MIIP-141H
Product Overview: Recombinant Human Migration and Invasion-Inhibitory Protein/MIIP is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Pro388) of Human MIIP fused with a polyhistidine tag at the C-terminus.
Description: Migration and Invasion-Inhibitory Protein (MIIP) was initially discovered in a yeast two-hybrid screen for proteins that interact with and inhibit the migration and invasion-promoting protein insulin-like growth factor binding protein 2 (IGFBP2). It is reported that MIIP not only modulates IGFBP2 but also regulates microtubule by binding to and inhibiting HDAC6, a class 2 histone deacetylase that deacetylates α-tubulin, heat-shock protein 90 (HSP90), and cortactin. In addition, MIIP also regulates the mitosis checkpoint, another microtubule-associated process.
Source: HEK293
Species: Human
Tag: His
AA Sequence: MVEAEELAQLRLLNLELLRQLWVGQDAVRRSVARAASESSLESSSSYNSETPSTPETSSTSLSTS CPRGRSSVWGPPDACRGDLRDVARSGVASLPPANCQHQESLGRPRPHSAPSLGTSSLRDPEPSGR LGDPGPQEAQTSRSILAQQSKLSKPRVTFSEESAVPERSWRLRPYLGYDWIAGSLDTSSSITSQP EAFFSKLQEFRETNKEECICSHPEPQLPGLRESSGSGVEEDHECVYCYRVNRRLFPVPVDPGTPC RLCRTPRDQQGPGTLAQPAHVRVSIPLSILEPPHRYHIHRRKSFDASDTLALPRHCLLGWDIFPP KSEKSSAPRNLDLWSSVSAEAQHQKLSGTSSPFHPASPMQMLPPTPTWSVPQVPRPHVPRQKPVD HHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name: MIIP migration and invasion inhibitory protein [ Homo sapiens ]
Official Symbol: MIIP
Synonyms: MIIP; migration and invasion inhibitory protein; migration and invasion-inhibitory protein; FLJ12438; IIp45; invasion inhibitory protein 45; IGFBP2-binding protein; invasion-inhibitory protein 45; IIP45; RP5-1077B9.4; FLJ38609;
Gene ID: 60672
mRNA Refseq: NM_021933
Protein Refseq: NP_068752
MIM: 608772
UniProt ID: Q5JXC2
Chromosome Location: 1p36.22

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.