"PCDHA6" Related Products

Recombinant Human PCDHA6, His-tagged

Cat.No.: PCDHA6-169H
Product Overview: Recombinant Human Protocadherin α-6/PCDHA6 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln30-Asn697) of Human PCDHA6 fused with a 6His tag at the C-terminus.
Description: Protocadherin α-6 (PCDHA6) is a single-pass type I membrane protein that contains six cadherin domains. PCDHA6 is a member of the protocadherin α gene cluster. The α gene cluster is composed of 15 cadherin superfamily genes related to CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. PCDHA6 is a potential calcium-dependent cell-adhesion protein. PCDHA6 may be involved in the establishment and maintenance of specific neuronal connections in the brain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain.
Source: HEK293
Species: Human
Tag: His
AA Sequence: QLHYSVPEEAKHGTFVGRIAQDLGLELAELVPRLFRMASKDREDLLEVNLQNGILFVNSRIDREE LCGRSAECSIHLEVIVDRPLQVFHVDVEVRDINDNPPLFPVEEQRVLIYESRLPDSVFPLEGASD ADVGSNSILTYKLSSSEYFGLDVKINSDDNKQIGLLLKKSLDREEAPAHNLFLTATDGGKPELTG TVQLLVTVLDVNDNAPTFEQSEYEVRIFENADNGTTVIRLNASDRDEGANGAISYSFNSLVAAMV IDHFSIDRNTGEIVIRGNLDFEQENLYKILIDATDKGHPPMAGHCTVLVRILDKNDNVPEIALTS LSLPVREDAQFGTVIALISVNDLDSGANGQVNCSLTPHVPFKLVSTFKNYYSLVLDSALDRESVS AYELVVTARDGGSPSLWATASLSVEVADMNDNAPAFAQPEYTVFVKENNPPGCHIFTVSARDADA QENALVSYSLVERRVGERALSSYISVHAESGKVYALQPLDHEELELLQFQVSARDAGVPPLGSNV TLQVFVLDENDNAPALLAPRVGGTGGAVSELVPRSLGAGQVVAKVRAVDADSGYNAWLSYELQPP ASSARFPFRVGLYTGEISTTRVLDEADSPRHRLLVLVKDHGEPALTATATVLVSLVESGQAPKAS SRASVGAAGPEAALVDVNVDHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by reducing SDS-PAGE.
Gene Name: PCDHA6 protocadherin alpha 6 [ Homo sapiens ]
Official Symbol: PCDHA6
Synonyms: PCDHA6; protocadherin alpha 6; CNRS2; protocadherin alpha-6; CNR2; CRNR2; KIAA0345 like 8; PCDH ALPHA6; PCDH-alpha-6; KIAA0345-like 8; CNRN2; PCDH-ALPHA6;
Gene ID: 56142
mRNA Refseq: NM_018909
Protein Refseq: NP_061732
MIM: 606312
UniProt ID: Q9UN73
Chromosome Location: 5q31
Function: calcium ion binding;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.