Recombinant Human PCDHA6, His-tagged
| Cat.No. : | PCDHA6-169H |
| Product Overview : | Recombinant Human Protocadherin α-6/PCDHA6 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln30-Asn697) of Human PCDHA6 fused with a 6His tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | 30-697 a.a. |
| Description : | Protocadherin α-6 (PCDHA6) is a single-pass type I membrane protein that contains six cadherin domains. PCDHA6 is a member of the protocadherin α gene cluster. The α gene cluster is composed of 15 cadherin superfamily genes related to CNR genes and consists of 13 highly similar and 2 more distantly related coding sequences. PCDHA6 is a potential calcium-dependent cell-adhesion protein. PCDHA6 may be involved in the establishment and maintenance of specific neuronal connections in the brain. These neural cadherin-like cell adhesion proteins are integral plasma membrane proteins that most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. |
| AA Sequence : | QLHYSVPEEAKHGTFVGRIAQDLGLELAELVPRLFRMASKDREDLLEVNLQNGILFVNSRIDREE LCGRSAECSIHLEVIVDRPLQVFHVDVEVRDINDNPPLFPVEEQRVLIYESRLPDSVFPLEGASD ADVGSNSILTYKLSSSEYFGLDVKINSDDNKQIGLLLKKSLDREEAPAHNLFLTATDGGKPELTG TVQLLVTVLDVNDNAPTFEQSEYEVRIFENADNGTTVIRLNASDRDEGANGAISYSFNSLVAAMV IDHFSIDRNTGEIVIRGNLDFEQENLYKILIDATDKGHPPMAGHCTVLVRILDKNDNVPEIALTS LSLPVREDAQFGTVIALISVNDLDSGANGQVNCSLTPHVPFKLVSTFKNYYSLVLDSALDRESVS AYELVVTARDGGSPSLWATASLSVEVADMNDNAPAFAQPEYTVFVKENNPPGCHIFTVSARDADA QENALVSYSLVERRVGERALSSYISVHAESGKVYALQPLDHEELELLQFQVSARDAGVPPLGSNV TLQVFVLDENDNAPALLAPRVGGTGGAVSELVPRSLGAGQVVAKVRAVDADSGYNAWLSYELQPP ASSARFPFRVGLYTGEISTTRVLDEADSPRHRLLVLVKDHGEPALTATATVLVSLVESGQAPKAS SRASVGAAGPEAALVDVNVDHHHHHH |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
| Gene Name | PCDHA6 protocadherin alpha 6 [ Homo sapiens ] |
| Official Symbol | PCDHA6 |
| Synonyms | PCDHA6; protocadherin alpha 6; CNRS2; protocadherin alpha-6; CNR2; CRNR2; KIAA0345 like 8; PCDH ALPHA6; PCDH-alpha-6; KIAA0345-like 8; CNRN2; PCDH-ALPHA6; |
| Gene ID | 56142 |
| mRNA Refseq | NM_018909 |
| Protein Refseq | NP_061732 |
| MIM | 606312 |
| UniProt ID | Q9UN73 |
| Chromosome Location | 5q31 |
| Function | calcium ion binding; |
| ◆ Recombinant Proteins | ||
| PCDHA6-169H | Recombinant Human PCDHA6, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PCDHA6-3396HCL | Recombinant Human PCDHA6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PCDHA6 Products
Required fields are marked with *
My Review for All PCDHA6 Products
Required fields are marked with *
