Recombinant Human FKBP7, His-tagged FKBP7-173H

Recombinant Human FKBP7, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human FKBP7, His-tagged

Recombinant Human FKBP7, His-tagged

FKBP7 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : FKBP7-173H
Product Overview : Recombinant Human Peptidyl-Prolyl Cis-Trans Isomerase FKBP7/FKBP7 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln24-Leu222) of Human FKBP7 fused with a 6His tag at the C-terminus.
Description : Peptidyl-Prolyl Cis-Trans Isomerase FKBP7 (FKBP7) is a member of the FKBP-type peptidyl-prolyl cis/trans isomerase (PPIase) family. FKBP7 contains two EF-hand domains and one PPIase FKBP-type domain. FKBP7 exhibits PPIase activity and function as molecular chaperones. In addition, FKBP7 accelerates the folding of proteins during protein synthesis. It has been shown that Hsp90 complex to the nucleus bind its PPIase domain to cytoplasmic dynein, the motor protein responsible for retrograde movement along microtubules.
Source : HEK293
Species : Human
Tag : His
AA Sequence : QRQKKEESTEEVKIEVLHRPENCSKTSKKGDLLNAHYDGYLAKDGSKFYCSRTQNEGHPKWFVLG VGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKIPPDATLIFEIELYAVTKGPRSIET FKQIDMDNDRQLSKAEINLYLQREFEKDEKPRDKSYQDAVLEDIFKKNDHDGDGFISPKEYNVYQ HDELVDHHHHHH
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by reducing SDS-PAGE.
Gene Name : FKBP7 FK506 binding protein 7 [ Homo sapiens ]
Official Symbol : FKBP7
Synonyms : FKBP7; FK506 binding protein 7; peptidyl-prolyl cis-trans isomerase FKBP7; FKBP23; FKBP-7; FKBP-23; rotamase; 23 kDa FKBP; PPIase FKBP7; FK506-binding protein 7; FK506-binding protein 23; 23 kDa FK506-binding protein; PPIase; MGC9420;
Gene ID : 51661
mRNA Refseq : NM_001135212
Protein Refseq : NP_001128684
MIM : 607062
UniProt ID : Q9Y680
Chromosome Location : 2q31.2
Function : FK506 binding; calcium ion binding; isomerase activity; peptidyl-prolyl cis-trans isomerase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy