"SERPINE2" Related Products

Expand
Expand
Expand

Recombinant Human SERPINE2, His-tagged

Cat.No.: SERPINE2-187H
Product Overview: Recombinant Human Serpin E2/SERPINE2 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ser20-Pro397) of Human SERPINE2 fused with a polyhistidine tag at the C-terminus.
Description: Serpin E2 is a secreted protein that belongs to the serpin family. Serpin E2 is a serine protease inhibitor with activity toward thrombin, trypsin, and urokinase. Serpin E2 expression is weak or absent in all normal pancreas and chronic pancreatitis tissue. In contrast, it was strongly over-expressed in the majority of pancreatic carcinoma as well as gastric and colorectal cancer samples. Serpin E2 promotes neurite extension by inhibiting thrombin. It also can bind heparin. It has been shown that Serpin E2 is a novel target of ERK signaling involved in human colorectal tumorigenesis.
Source: HEK293
Species: Human
Tag: His
AA Sequence: MNWHLPLFLLASVTLPSICSHFNPLSLEELGSNTGIQVFNQIVKSRPHDNIVISPHGIASVLGML QLGADGRTKKQLAMVMRYGVNGVGKILKKINKAIVSKKNKDIVTVANAVFVKNASEIEVPFVTRN KDVFQCEVRNVNFEDPASACDSINAWVKNETRDMIDNLLSPDLIDGVLTRLVLVNAVYFKGLWKS RFQPENTKKRTFVAADGKSYQVPMLAQLSVFRCGSTSAPNDLWYNFIELPYHGESISMLIALPTE SSTPLSAIIPHISTKTIDSWMSIMVPKRVQVILPKFTAVAQTDLKEPLKVLGITDMFDSSKANFA KITRSENLHVSHILQKAKIEVSEDGTKASAATTAILIARSSPPWFIVDRPFLFFIRHNPTGAVLF MGQINKPHHHHHH
Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Gene Name: SERPINE2 serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 2 [ Homo sapiens ]
Official Symbol: SERPINE2
Synonyms: SERPINE2; serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 2; PI7, serine (or cysteine) proteinase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 2; glia-derived nexin; GDN; glial derived nexin 1; nexin; PN1; PNI; serpin E2; protease nexin I; peptidase inhibitor 7; glial-derived neurite promoting factor; PI7; PI-7; PN-1; DKFZp686A13110;
Gene ID: 5270
mRNA Refseq: NM_001136528
Protein Refseq: NP_001130000
MIM: 177010
UniProt ID: P07093
Chromosome Location: 2q33-q35
Function: glycosaminoglycan binding; heparin binding; peptidase inhibitor activity; protein binding; receptor binding; serine-type endopeptidase inhibitor activity; serine-type endopeptidase inhibitor activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.