"CCR5" Related Products

Expand
Expand
Expand

Recombinant Human CCR5, GST-tagged

Cat.No.: CCR5-120H
Product Overview: CCR5 (XP_001125981.1, 1 a.a. - 352 a.a.) recombinant protein with a ~26kD N-terminal GST tag..
Description: This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. This protein is expressed by T cells and macrophages, and is known to be an important co-receptor for macrophage-tropic virus, including HIV, to enter host cells. Defective alleles of this gene have been associated with the HIV infection resistance. The ligands of this receptor include monocyte chemoattractant protein 2 (MCP-2), macrophage inflammatory protein 1 alpha (MIP-1 alpha), macrophage inflammatory protein 1 beta (MIP-1 beta) and regulated on activation normal T expressed and secreted protein (RANTES). Expression of this gene was also detected in a promyeloblastic cell line, suggesting that this protein may play a role in granulocyte lineage proliferation and differentiation. This gene is located at the chemokine receptor gene cluster region. Two transcript variants encoding the same protein have been found for this gene.
Source: Wheat germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 66.9 kDa
AA Sequence: MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAIS DLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIF FIILLTIDRYLAVVHAVFALKARTVTFGVVTS VITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRC RNEKKRHRAV RLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYA FVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
Applications: Western Blot; ELISA; Protein Array; Antibody Production
Storage: Store at -80C. Avoid freeze-thaw cycles.
Gene Name: CCR5 chemokine (C-C motif) receptor 5 (gene/pseudogene) [ Homo sapiens (human) ]
Official Symbol: CCR5
Synonyms: CCR5; CKR5; CCR-5; CD195; CKR-5; CCCKR5; CMKBR5; IDDM22; CC-CKR-5; chemokine (C-C motif) receptor 5 (gene/pseudogene); C-C chemokine receptor type 5; chemr13; HIV-1 fusion coreceptor; chemokine receptor CCR5; C-C motif chemokine receptor 5 A159A
Gene ID: 1234
mRNA Refseq: NM_000579
Protein Refseq: NP_000570
MIM: 601373
UniProt ID: P51681
Chromosome Location: 3p21.31
Pathway: Binding and entry of HIV virion; Chemokine receptors bind chemokines; Class A/1 (Rhodopsin-like receptors)
Function: C-C chemokine binding; chemokine (C-C motif) ligand 5 binding; phosphatidylinositol phospholipase C activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.