Recombinant Human IL36B protein

Cat.No. : IL36B-509H
Product Overview : Recombinant Human IL36B protein (Interleukin-36 beta, 153a.a.) was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 153
Description : Interleukin-36 (IL-36) is a pro-inflammatory cytokine which plays an important role in the pathophysiology of several diseases. IL-36α, IL-36β, and IL-36γ (formerly IL-1F6, IL-1F8, and IL-1F9) are IL-1 family members that signal through the IL-1 receptor family members IL-1Rrp2 (IL-1RL2) and IL-1RAcP. IL-36 beta is reported to be expressed at higher levels in psoriatic plaques than in symptomless psoriatic skin or healthy control skin and it can stimulate production of interleukin-6 and interleukin-8 in synovial fibrobasts, articular chondrocytes and mature adipocytes. It has two isoforms. IL-36β isoform 2 contains one potential N-linked glycosylation site in its C-terminus, while IL-36β isoform 1 lacks potential N-linked glycosylation sites and four of the conserved β-strands. Human IL-36βisoform 2 shares 62 %, 67 %, 63 % and 59 % a.a. identity with the most similar isoform of mouse, canine, bovine and equine IL-36β, respectively.
Form : Lyophilized from a 0.2μm filtered concentrated solution in 2 × PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by inducing IL-8 secretion in human preadipocytes is less than 10 ng/ml, corresponding to a specific activity of > 1.0 × 10⁵ IU/mg.
Molecular Mass : Approximately 17.2 kDa, a single non-glycosylated polypeptide chain containing 153 amino acids.
AA Sequence : REAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE
Endotoxin : Less than 1 EU/μg of rHuIL-36β, 153a.a. as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name IL36B
Official Symbol IL36B
Synonyms IL36B; interleukin 36, beta; IL1F8, interleukin 1 family, member 8 (eta); interleukin-36 beta; FIL1; FILI (ETA); IL 1F8; IL 1H2; IL1 ETA; IL1H2; MGC126880; MGC126882; FIL1 eta; IL-1 eta; IL-1F8 (FIL1-eta); interleukin-1 eta; interleukin 1, eta; interleukin-1 homolog 2; Interleukin-1 Superfamily e; family of interleukin 1-eta; interleukin-1 family member 8; IL1F8 (Canonical product IL-1F8a); interleukin 1 family, member 8 (eta); FIL1H; IL1F8; IL-1F8; IL-1H2; IL1-ETA; FIL1-(ETA); FILI-(ETA);
Gene ID 27177
mRNA Refseq NM_014438
Protein Refseq NP_055253
MIM 605508
UniProt ID Q9NZH7-2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL36B Products

Required fields are marked with *

My Review for All IL36B Products

Required fields are marked with *

0
cart-icon
0
compare icon