Recombinant Human IL36B protein, His-tagged
Cat.No. : | IL36B-7519H |
Product Overview : | Recombinant Human IL36B protein(NP_055253)(1-157 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-157 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | IL36B interleukin 36, beta [ Homo sapiens ] |
Official Symbol | IL36B |
Synonyms | IL36B; interleukin 36, beta; IL1F8, interleukin 1 family, member 8 (eta); interleukin-36 beta; FIL1; FILI (ETA); IL 1F8; IL 1H2; IL1 ETA; IL1H2; MGC126880; MGC126882; FIL1 eta; IL-1 eta; IL-1F8 (FIL1-eta); interleukin-1 eta; interleukin 1, eta; interleukin-1 homolog 2; Interleukin-1 Superfamily e; family of interleukin 1-eta; interleukin-1 family member 8; IL1F8 (Canonical product IL-1F8a); interleukin 1 family, member 8 (eta); FIL1H; IL1F8; IL-1F8; IL-1H2; IL1-ETA; FIL1-(ETA); FILI-(ETA); |
Gene ID | 27177 |
mRNA Refseq | NM_014438.3 |
Protein Refseq | NP_055253 |
MIM | 605508 |
UniProt ID | Q9NZH7 |
◆ Recombinant Proteins | ||
Il1f8-745M | Recombinant Mouse Il1f8 protein | +Inquiry |
IL36B-151H | Recombinant Human IL36B Protein, His-tagged | +Inquiry |
IL36B-752H | Recombinant Human IL36B protein(Met1-Glu157) | +Inquiry |
IL1F8-14172H | Recombinant Human IL1F8, GST-tagged | +Inquiry |
Il1f8-646M | Recombinant Mouse Il1f8 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL36B-5236HCL | Recombinant Human IL1F8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL36B Products
Required fields are marked with *
My Review for All IL36B Products
Required fields are marked with *
0
Inquiry Basket