Recombinant Human IL36B protein, His-tagged

Cat.No. : IL36B-7519H
Product Overview : Recombinant Human IL36B protein(NP_055253)(1-157 aa), fused to His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-157 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name IL36B interleukin 36, beta [ Homo sapiens ]
Official Symbol IL36B
Synonyms IL36B; interleukin 36, beta; IL1F8, interleukin 1 family, member 8 (eta); interleukin-36 beta; FIL1; FILI (ETA); IL 1F8; IL 1H2; IL1 ETA; IL1H2; MGC126880; MGC126882; FIL1 eta; IL-1 eta; IL-1F8 (FIL1-eta); interleukin-1 eta; interleukin 1, eta; interleukin-1 homolog 2; Interleukin-1 Superfamily e; family of interleukin 1-eta; interleukin-1 family member 8; IL1F8 (Canonical product IL-1F8a); interleukin 1 family, member 8 (eta); FIL1H; IL1F8; IL-1F8; IL-1H2; IL1-ETA; FIL1-(ETA); FILI-(ETA);
Gene ID 27177
mRNA Refseq NM_014438.3
Protein Refseq NP_055253
MIM 605508
UniProt ID Q9NZH7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL36B Products

Required fields are marked with *

My Review for All IL36B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon