Recombinant Human IFNW1 protein

Cat.No. : IFNW1-534H
Product Overview : Recombinant Human IFNW1 protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 172
Description : Interferon-Omega (IFN-ω) coded by IFNW1 gene in human, is a number of the type I interferon family, which includes IFN-α, IFN-β, and IFN-ω. The IFNAR-1/IFNAR-2 receptor complex can help with the signal transduction, followed the antiviral or the antiproliferative actions. IFN-ω is derived from IFN-α/β and share 75 % sequence with IFN-α. It has two intramolecular disulfide bonds which are crucial for activities. Mire-Sluis et al have described bioassays for IFN-α, IFN-β, and IFN-ω that exploit the ability of these factors to inhibit proliferation of TF-1 cells induced by GM-CSF. The bioassays can be used also with Epo and TF-1 cells, or Epo and Epo-transfected UT-7 cells.
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a chemotaxis bioassay using human TF-1 cells is less than 0.01 ng/ml, corresponding to a specific activity of > 1.0 × 10⁸ IU/mg.
Molecular Mass : Approximately 20.0 kDa, containing 172 amino acid residues with two conserved disulfide bonds.
AA Sequence : CDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSS
Endotoxin : Less than 1 EU/μg of rHuIFN-ω as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name IFNW1
Official Symbol IFNW1
Synonyms IFNW1; interferon, omega 1; interferon omega-1; IFN omega 1; interferon omega 1; interferon alpha-II-1; IFN-omega 1, interferon omega-1;
Gene ID 3467
mRNA Refseq NM_002177
Protein Refseq NP_002168
MIM 147553
UniProt ID P05000

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IFNW1 Products

Required fields are marked with *

My Review for All IFNW1 Products

Required fields are marked with *

0
cart-icon
0
compare icon