"IFNW1" Related Products

Expand

Recombinant Human IFNW1 Protein, His-tagged

Cat.No. : IFNW1-947H
Product Overview : Recombinant Human IFNW1 fused with His tag at C-terminal was expressed in HEK293 cells.
Description : The protein encoded by this gene is an interferon and possesses antiviral activity. The encoded protein binds to the interferon alpha/beta receptor but not to the interferon gamma receptor. This intronless gene has several pseudogenes spread throughout the genome.
Source : HEK293 cells
Tag : His
Form : Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH7.4
Molecular Mass : 21.1kD
AA Sequence : LGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSSVDHHHHHH*
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Gene Name : IFNW1 interferon, omega 1 [ Homo sapiens ]
Official Symbol : IFNW1
Synonyms : IFNW1; interferon, omega 1; interferon omega-1; IFN omega 1; interferon omega 1; interferon alpha-II-1; IFN-omega 1, interferon omega-1;
Gene ID : 3467
mRNA Refseq : NM_002177
Protein Refseq : NP_002168
MIM : 147553
UniProt ID : P05000

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.