Recombinant Human IFNW1 Protein, His-tagged
Cat.No. : | IFNW1-947H |
Product Overview : | Recombinant Human IFNW1 fused with His tag at C-terminal was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Description : | The protein encoded by this gene is an interferon and possesses antiviral activity. The encoded protein binds to the interferon alpha/beta receptor but not to the interferon gamma receptor. This intronless gene has several pseudogenes spread throughout the genome. |
Form : | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH7.4 |
Molecular Mass : | 21.1kD |
AA Sequence : | LGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFRFPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLETCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTNMQERLRSKDRDLGSSVDHHHHHH* |
Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
Concentration : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | IFNW1 interferon, omega 1 [ Homo sapiens ] |
Official Symbol | IFNW1 |
Synonyms | IFNW1; interferon, omega 1; interferon omega-1; IFN omega 1; interferon omega 1; interferon alpha-II-1; IFN-omega 1, interferon omega-1; |
Gene ID | 3467 |
mRNA Refseq | NM_002177 |
Protein Refseq | NP_002168 |
MIM | 147553 |
UniProt ID | P05000 |
◆ Recombinant Proteins | ||
IFNW1-157H | Active Recombinant Human IFNW1 Protein (Cys24-Ser195), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IFNW1-01H | Active Recombinant Human IFNW1 Protein (22-195aa), C-His tagged | +Inquiry |
IFNW1-1255B | Recombinant Bovine IFNW1 Protein, His-SUMO-tagged | +Inquiry |
IFNW1-086H | Active Recombinant Human IFNW1 Protein | +Inquiry |
IFNW1-8533H | Active Recombinant Human IFNW1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNW1-1382HCL | Recombinant Human IFNW1 cell lysate | +Inquiry |
IFNW1-2929HCL | Recombinant Human IFNW1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNW1 Products
Required fields are marked with *
My Review for All IFNW1 Products
Required fields are marked with *