Recombinant Bovine IFNW1 Protein, His-SUMO-tagged
| Cat.No. : | IFNW1-1255B |
| Product Overview : | Recombinant Bovine IFNW1 Protein (24-195aa) was expressed in E. coli with N-terminal His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Bovine |
| Source : | E.coli |
| Tag : | His&SUMO |
| Protein Length : | 24-195 a.a. |
| Form : | Tris-based buffer, 50% glycerol. |
| Molecular Mass : | 35.7 kDa |
| AA Sequence : | CDLSPNHVLVGRQNLRLLGQMRRLSPRFCLQDRKDFAFPQEMVEVSQFQEAQAISVLHEMLQQSFNLFHK ERSSAAWDTTLLEQLLTGLHQQLDDLDACLGLLTGEEDSALGRTGPTLAMKRYFQGIHVYLQEKGYSDCA WEIVRLEIMRSLSSSTSLQERLRMMDGDLKSP |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Gene Name | IFNW1 interferon, omega 1 [ Bos taurus (cattle) ] |
| Official Symbol | IFNW1 |
| Synonyms | IFNW1; interferon, omega 1; IFN-omega-c1; Interferon alpha-II-1 |
| Gene ID | 281847 |
| mRNA Refseq | NM_174351.1 |
| Protein Refseq | NP_776776.1 |
| UniProt ID | P07352 |
| ◆ Recombinant Proteins | ||
| IFNW1-47H | Recombinant Human Interferon, Omega 1 | +Inquiry |
| IFNW1-01H | Active Recombinant Human IFNW1 Protein (22-195aa), C-His tagged | +Inquiry |
| IFNW1-8533H | Active Recombinant Human IFNW1 protein, His-tagged | +Inquiry |
| IFNW1-1255B | Recombinant Bovine IFNW1 Protein, His-SUMO-tagged | +Inquiry |
| IFNW1-947H | Recombinant Human IFNW1 Protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IFNW1-2929HCL | Recombinant Human IFNW1 cell lysate | +Inquiry |
| IFNW1-1382HCL | Recombinant Human IFNW1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNW1 Products
Required fields are marked with *
My Review for All IFNW1 Products
Required fields are marked with *
