Recombinant Bovine IFNW1 Protein, His-SUMO-tagged
Cat.No. : | IFNW1-1255B |
Product Overview : | Recombinant Bovine IFNW1 Protein (24-195aa) was expressed in E. coli with N-terminal His-SUMO-tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 24-195 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 35.7 kDa |
AA Sequence : | CDLSPNHVLVGRQNLRLLGQMRRLSPRFCLQDRKDFAFPQEMVEVSQFQEAQAISVLHEMLQQSFNLFHK ERSSAAWDTTLLEQLLTGLHQQLDDLDACLGLLTGEEDSALGRTGPTLAMKRYFQGIHVYLQEKGYSDCA WEIVRLEIMRSLSSSTSLQERLRMMDGDLKSP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | IFNW1 interferon, omega 1 [ Bos taurus (cattle) ] |
Official Symbol | IFNW1 |
Synonyms | IFNW1; interferon, omega 1; IFN-omega-c1; Interferon alpha-II-1 |
Gene ID | 281847 |
mRNA Refseq | NM_174351.1 |
Protein Refseq | NP_776776.1 |
UniProt ID | P07352 |
◆ Recombinant Proteins | ||
IFNW1-01H | Active Recombinant Human IFNW1 Protein (22-195aa), C-His tagged | +Inquiry |
IFNW1-157H | Active Recombinant Human IFNW1 Protein (Cys24-Ser195), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IFNW1-1255B | Recombinant Bovine IFNW1 Protein, His-SUMO-tagged | +Inquiry |
IFNW1-3103H | Recombinant Human IFNW1 Protein (Leu22-Ser195), C-His tagged | +Inquiry |
IFNW1-947H | Recombinant Human IFNW1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNW1-1382HCL | Recombinant Human IFNW1 cell lysate | +Inquiry |
IFNW1-2929HCL | Recombinant Human IFNW1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IFNW1 Products
Required fields are marked with *
My Review for All IFNW1 Products
Required fields are marked with *