Recombinant Human ITGBL1 protein, GST-tagged

Cat.No. : ITGBL1-184H
Product Overview : Recombinant Human ITGBL1 Protein(NP_001258683.1)(145-494 aa) is expressed from E. coli with a GST Tag.
Availability December 14, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 145-494 aa
Description : This gene encodes a beta integrin-related protein that is a member of the EGF-like protein family. The encoded protein contains integrin-like cysteine-rich repeats. Alternative splicing results in multiple transcript variants.
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4), 5% trehalose and 5% mannitol are added as protectants before lyophilization.
Bio-activity : Not tested
AA Sequence : NSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGVVCGGHGTCSCGRCVCERGWFGKLCQHPRKCNMTEEQSKNLCESADGILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLGSEYP
Endotoxin : <1.0 EU per μg protein as determined by the LAL method.
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Applications : on:
Blocking peptide
Stability : Store for up to 12 months at -20°C to -80°C as lyophilized powder.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200μl sterile water for short-term storage.
Reconstitution with 200μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Shipping : The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below).
Gene Name ITGBL1
Official Symbol ITGBL1
Synonyms OSCP; TIED
Gene ID 9358
mRNA Refseq NM_001271754.2
Protein Refseq NP_001258683.1
MIM 604234
UniProt ID O95965

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITGBL1 Products

Required fields are marked with *

My Review for All ITGBL1 Products

Required fields are marked with *

0
cart-icon
0
compare icon