Recombinant Human ITGBL1 protein, His&Myc-tagged
Cat.No. : | ITGBL1-4335H |
Product Overview : | Recombinant Human ITGBL1 protein(O95965)(24-494aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 24-494aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 58.9 kDa |
AA Sequence : | VPQSFSPSLRSWPGAACRLSRAESERRCRAPGQPPGAALCHGRGRCDCGVCICHVTEPGMFFGPLCECHEWVCETYDGSTCAGHGKCDCGKCKCDQGWYGDACQYPTNCDLTKKKSNQMCKNSQDIICSNAGTCHCGRCKCDNSDGSGLVYGKFCECDDRECIDDETEEICGGHGKCYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCKAGWYGKKCEHPQSCTLSAEESIRKCQGSSDLPCSGRGKCECGKCTCYPPGDRRVYGKTCECDDRRCEDLDGVVCGGHGTCSCGRCVCERGWFGKLCQHPRKCNMTEEQSKNLCESADGILCSGKGSCHCGKCICSAEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLGSEYP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | ITGBL1 integrin, beta-like 1 (with EGF-like repeat domains) [ Homo sapiens ] |
Official Symbol | ITGBL1 |
Synonyms | ITGBL1; integrin, beta-like 1 (with EGF-like repeat domains); integrin beta-like protein 1; integrin beta like 1; OSCP; ten integrin EGF like repeat domains protein; TIED; osteoblast-specific cysteine-rich protein; ten integrin EGF-like repeat domains protein; ten integrin EGF-like repeat domain-containing protein; |
Gene ID | 9358 |
mRNA Refseq | NM_004791 |
Protein Refseq | NP_004782 |
MIM | 604234 |
UniProt ID | O95965 |
◆ Recombinant Proteins | ||
ITGBL1-1309H | Recombinant Human ITGBL1 protein, His&Myc-tagged | +Inquiry |
RFL25020MF | Recombinant Full Length Mouse Integrin Beta-Like Protein 1(Itgbl1) Protein, His&Myc-Tagged | +Inquiry |
Itgbl1-4334M | Recombinant Mouse Itgbl1 protein, His&Myc-tagged | +Inquiry |
ITGBL1-3118R | Recombinant Rat ITGBL1 Protein | +Inquiry |
ITGBL1-4335H | Recombinant Human ITGBL1 protein, His&Myc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGBL1-5120HCL | Recombinant Human ITGBL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ITGBL1 Products
Required fields are marked with *
My Review for All ITGBL1 Products
Required fields are marked with *