Recombinant Mouse Itgbl1 protein, His&Myc-tagged

Cat.No. : Itgbl1-4334M
Product Overview : Recombinant Mouse Itgbl1 protein(Q8VDV0)(24-494aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His&Myc
Protein Length : 24-494aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 58.9kDa
AA Sequence : APQSFLPSLRSLSGAPCRLSRAESERRCRAPGQPPGSALCHDRGRCECGVCICHVTEPGTYFGPLCECHEWICETYDGKTCAGHGNCDCGKCKCDVGWSGEACQYPTKCDLTKKISNQMCKNSQDVICSNAGTCHCGRCKCDNSDGHGLIYGKFCECDDRECIDDETEEVCGGHGKCYCGNCYCEAGWHGDKCEFQCDITPWESKRRCTSPDGKVCSNRGTCVCGECSCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCRAGWYGKKCEHPRNCPLSAEESTKKCQGSSDLPCSGRGRCECGRCTCYPPGDSRVYGKTCECDDRRCEDLDGVVCGGHGMCSCGRCVCEKGWFGKLCQHLRKCNMTEEQSRSLCESADGTLCSGKGSCHCGKCICSGEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLGTEYP
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name Itgbl1 integrin, beta-like 1 [ Mus musculus ]
Official Symbol Itgbl1
Synonyms ITGBL1; integrin, beta-like 1; integrin beta-like protein 1; with EGF-like repeat domains; B930011D01Rik;
Gene ID 223272
mRNA Refseq NM_145467
Protein Refseq NP_663442

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Itgbl1 Products

Required fields are marked with *

My Review for All Itgbl1 Products

Required fields are marked with *

0
cart-icon
0
compare icon