Recombinant Mouse Itgbl1 protein, His&Myc-tagged
Cat.No. : | Itgbl1-4334M |
Product Overview : | Recombinant Mouse Itgbl1 protein(Q8VDV0)(24-494aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 24-494aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 58.9kDa |
AA Sequence : | APQSFLPSLRSLSGAPCRLSRAESERRCRAPGQPPGSALCHDRGRCECGVCICHVTEPGTYFGPLCECHEWICETYDGKTCAGHGNCDCGKCKCDVGWSGEACQYPTKCDLTKKISNQMCKNSQDVICSNAGTCHCGRCKCDNSDGHGLIYGKFCECDDRECIDDETEEVCGGHGKCYCGNCYCEAGWHGDKCEFQCDITPWESKRRCTSPDGKVCSNRGTCVCGECSCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCDCRAGWYGKKCEHPRNCPLSAEESTKKCQGSSDLPCSGRGRCECGRCTCYPPGDSRVYGKTCECDDRRCEDLDGVVCGGHGMCSCGRCVCEKGWFGKLCQHLRKCNMTEEQSRSLCESADGTLCSGKGSCHCGKCICSGEEWYISGEFCDCDDRDCDKHDGLICTGNGICSCGNCECWDGWNGNACEIWLGTEYP |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Itgbl1 integrin, beta-like 1 [ Mus musculus ] |
Official Symbol | Itgbl1 |
Synonyms | ITGBL1; integrin, beta-like 1; integrin beta-like protein 1; with EGF-like repeat domains; B930011D01Rik; |
Gene ID | 223272 |
mRNA Refseq | NM_145467 |
Protein Refseq | NP_663442 |
◆ Recombinant Proteins | ||
Itgbl1-4334M | Recombinant Mouse Itgbl1 protein, His&Myc-tagged | +Inquiry |
ITGBL1-3301H | Recombinant Human ITGBL1 Protein (Met1-Pro494), C-His tagged | +Inquiry |
ITGBL1-4648M | Recombinant Mouse ITGBL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ITGBL1-2774R | Recombinant Rat ITGBL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ITGBL1-2950Z | Recombinant Zebrafish ITGBL1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ITGBL1-5120HCL | Recombinant Human ITGBL1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Itgbl1 Products
Required fields are marked with *
My Review for All Itgbl1 Products
Required fields are marked with *