Recombinant Human KIF2B protein, His-tagged
| Cat.No. : | KIF2B-371H |
| Product Overview : | Recombinant Human KIF2B protein(NP_115948.4)(1 - 350 aa), fused to His-tag, was expressed in E.coli. |
| Availability | September 16, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1 - 350 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
| AA Sequence : | MASQFCLPESPCLSPLKPLKPHFGDIQEGIYVAIQRSDKRIHLAVVTEINRENYWVTVEWVEKAVKKGKKIDLETILLLNPALDSAEHPMPPPPLSPLALAPSSAIRDQRTATKWVAMIPQKNQTASGDSLDVRVPSKPCLMKQKKSPCLWEIQKLQEQREKRRRLQQEIRARRALDVNTRNPNYEIMHMIEEYRRHLDSSKISVLEPPQEHRICVCVRKRPLNQRETTLKDLDIITVPSDNVVMVHESKQKVDLTRYLQNQTFCFDHAFDDKASNELVYQFTAQPLVESIFRKGMATCFAYGQTGSGKTYTMGGDFSGTAQDCSKGIYALVAQDVFLLLRNSTYEKLDL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
| Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature (see below). |
| Gene Name | KIF2B kinesin family member 2B [ Homo sapiens (human) ] |
| Official Symbol | KIF2B |
| Gene ID | 84643 |
| mRNA Refseq | NM_032559.5 |
| Protein Refseq | NP_115948.4 |
| UniProt ID | Q8N4N8 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KIF2B Products
Required fields are marked with *
My Review for All KIF2B Products
Required fields are marked with *
