Recombinant Human GLYR1 protein, His-tagged
Cat.No. : | GLYR1-1337H |
Product Overview : | Recombinant Human GLYR1 protein(133-484 aa), fused with His tag, was expressed in E.coli. |
Availability | September 16, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 133-484 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | WQPTASEPVKDADPHFHHFLLSQTEKPAVCYQAITKKLKICEEETGSTSIQAADSTAVNGSITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAVYRAYIH |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | GLYR1 glyoxylate reductase 1 homolog (Arabidopsis) [ Homo sapiens ] |
Official Symbol | GLYR1 |
Synonyms | GLYR1; glyoxylate reductase 1 homolog (Arabidopsis); putative oxidoreductase GLYR1; BM045; HIBDL; N PAC; NP60; nuclear protein 60kDa; nuclear protein NP60; nuclear protein 60 kDa; nuclear protein of 60 kDa; cytokine-like nuclear factor n-pac; 3-hydroxyisobutyrate dehydrogenase-like protein; N-PAC; |
Gene ID | 84656 |
mRNA Refseq | NM_032569 |
Protein Refseq | NP_115958 |
MIM | 610660 |
UniProt ID | Q49A26 |
◆ Recombinant Proteins | ||
GLYR1-1337H | Recombinant Human GLYR1 protein, His-tagged | +Inquiry |
GLYR1-1847Z | Recombinant Zebrafish GLYR1 | +Inquiry |
GLYR1-3042H | Recombinant Human GLYR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GLYR1-1006H | Recombinant Human GLYR1 | +Inquiry |
GLYR1-1709C | Recombinant Chicken GLYR1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLYR1-5886HCL | Recombinant Human GLYR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLYR1 Products
Required fields are marked with *
My Review for All GLYR1 Products
Required fields are marked with *