Recombinant Human GLYR1 protein, His-tagged

Cat.No. : GLYR1-1337H
Product Overview : Recombinant Human GLYR1 protein(133-484 aa), fused with His tag, was expressed in E.coli.
Availability December 18, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 133-484 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
AA Sequence : WQPTASEPVKDADPHFHHFLLSQTEKPAVCYQAITKKLKICEEETGSTSIQAADSTAVNGSITPTDKKIGFLGLGLMGSGIVSNLLKMGHTVTVWNRTAEKCDLFIQEGARLGRTPAEVVSTCDITFACVSDPKAAKDLVLGPSGVLQGIRPGKCYVDMSTVDADTVTELAQVIVSRGGRFLEAPVSGNQQLSNDGMLVILAAGDRGLYEDCSSCFQAMGKTSFFLGEVGNAAKMMLIVNMVQGSFMATIAEGLTLAQVTGQSQQTLLDILNQGQLASIFLDQKCQNILQGNFKPDFYLKYIQKDLRLAIALGDAVNHPTPMAAAANEVYKRAKALDQSDNDMSAVYRAYIH
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name GLYR1 glyoxylate reductase 1 homolog (Arabidopsis) [ Homo sapiens ]
Official Symbol GLYR1
Synonyms GLYR1; glyoxylate reductase 1 homolog (Arabidopsis); putative oxidoreductase GLYR1; BM045; HIBDL; N PAC; NP60; nuclear protein 60kDa; nuclear protein NP60; nuclear protein 60 kDa; nuclear protein of 60 kDa; cytokine-like nuclear factor n-pac; 3-hydroxyisobutyrate dehydrogenase-like protein; N-PAC;
Gene ID 84656
mRNA Refseq NM_032569
Protein Refseq NP_115958
MIM 610660
UniProt ID Q49A26

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLYR1 Products

Required fields are marked with *

My Review for All GLYR1 Products

Required fields are marked with *

0
cart-icon
0
compare icon