Recombinant Human RALA protein, His-tagged

Cat.No. : RALA-2165H
Product Overview : Recombinant Human RALA protein(1-206 aa), fused with N-terminal His tag, was expressed in E.coli.
Availability December 28, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-206 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name RALA v-ral simian leukemia viral oncogene homolog A (ras related) [ Homo sapiens ]
Official Symbol RALA
Synonyms RALA; v-ral simian leukemia viral oncogene homolog A (ras related); RAL; ras-related protein Ral-A; Ras family small GTP binding protein RALA; RAS like protein A; Ras related protein Ral A; RAS-like protein A; MGC48949;
Gene ID 5898
mRNA Refseq NM_005402
Protein Refseq NP_005393
MIM 179550
UniProt ID P11233

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RALA Products

Required fields are marked with *

My Review for All RALA Products

Required fields are marked with *

0
cart-icon
0
compare icon