Recombinant Human RALA protein, His-tagged
Cat.No. : | RALA-2165H |
Product Overview : | Recombinant Human RALA protein(1-206 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | August 23, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-206 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | RALA v-ral simian leukemia viral oncogene homolog A (ras related) [ Homo sapiens ] |
Official Symbol | RALA |
Synonyms | RALA; v-ral simian leukemia viral oncogene homolog A (ras related); RAL; ras-related protein Ral-A; Ras family small GTP binding protein RALA; RAS like protein A; Ras related protein Ral A; RAS-like protein A; MGC48949; |
Gene ID | 5898 |
mRNA Refseq | NM_005402 |
Protein Refseq | NP_005393 |
MIM | 179550 |
UniProt ID | P11233 |
◆ Recombinant Proteins | ||
RALA-2165H | Recombinant Human RALA protein, His-tagged | +Inquiry |
RALA-1777H | Recombinant Human V-Ral Simian Leukemia Viral Oncogene Homolog A (ras related), His-tagged | +Inquiry |
RALA-3386H | Recombinant Human RALA, His-tagged | +Inquiry |
RALA-4574R | Recombinant Rat RALA Protein, His (Fc)-Avi-tagged | +Inquiry |
RALA-3777R | Recombinant Rhesus monkey RALA Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RALA-2544HCL | Recombinant Human RALA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RALA Products
Required fields are marked with *
My Review for All RALA Products
Required fields are marked with *