Recombinant Human RALA protein, His-tagged
| Cat.No. : | RALA-2165H |
| Product Overview : | Recombinant Human RALA protein(1-206 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | February 03, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-206 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | RALA v-ral simian leukemia viral oncogene homolog A (ras related) [ Homo sapiens ] |
| Official Symbol | RALA |
| Synonyms | RALA; v-ral simian leukemia viral oncogene homolog A (ras related); RAL; ras-related protein Ral-A; Ras family small GTP binding protein RALA; RAS like protein A; Ras related protein Ral A; RAS-like protein A; MGC48949; |
| Gene ID | 5898 |
| mRNA Refseq | NM_005402 |
| Protein Refseq | NP_005393 |
| MIM | 179550 |
| UniProt ID | P11233 |
| ◆ Recombinant Proteins | ||
| RALA-4915R | Recombinant Rat RALA Protein | +Inquiry |
| RALA-6138H | Recombinant Human RALA Protein (Met1-Leu206), N-His tagged | +Inquiry |
| RALA-301581H | Recombinant Human RALA protein, GST-tagged | +Inquiry |
| RALA-2165H | Recombinant Human RALA protein, His-tagged | +Inquiry |
| RALA-3386H | Recombinant Human RALA, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RALA-2544HCL | Recombinant Human RALA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RALA Products
Required fields are marked with *
My Review for All RALA Products
Required fields are marked with *
