Recombinant Human RALA protein, GST-tagged
Cat.No. : | RALA-301581H |
Product Overview : | Recombinant Human RALA (1-206 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Leu206 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | RALA v-ral simian leukemia viral oncogene homolog A (ras related) [ Homo sapiens ] |
Official Symbol | RALA |
Synonyms | RALA; v-ral simian leukemia viral oncogene homolog A (ras related); RAL; ras-related protein Ral-A; Ras family small GTP binding protein RALA; RAS like protein A; Ras related protein Ral A; RAS-like protein A; MGC48949; |
Gene ID | 5898 |
mRNA Refseq | NM_005402 |
Protein Refseq | NP_005393 |
MIM | 179550 |
UniProt ID | P11233 |
◆ Recombinant Proteins | ||
RALA-3777R | Recombinant Rhesus monkey RALA Protein, His-tagged | +Inquiry |
RALA-3594R | Recombinant Rhesus Macaque RALA Protein, His (Fc)-Avi-tagged | +Inquiry |
RALA-4915R | Recombinant Rat RALA Protein | +Inquiry |
RALA-301581H | Recombinant Human RALA protein, GST-tagged | +Inquiry |
RALA-3386H | Recombinant Human RALA, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RALA-2544HCL | Recombinant Human RALA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RALA Products
Required fields are marked with *
My Review for All RALA Products
Required fields are marked with *
0
Inquiry Basket