Recombinant Human RBM16 protein, His-tagged RBM16-2209H

Recombinant Human RBM16 protein, His-tagged

PRODUCTS

Home / Products / Recombinant Human RBM16 protein, His-tagged

Recombinant Human RBM16 protein, His-tagged

SCAF8 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : RBM16-2209H
Product Overview : Recombinant Human RBM16 (921-1271aa) fussed with His tag at N-terminal was expressed in E. coli.
Source : E. coli
Species : Human
Tag : His
Form : 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), added with 300 mM Imidazole and 0.7% sarcosyl, 15% glycerol.
Molecular Mass : 44 kDa
Protein length : 921-1271aa
AA Sequence : MPMLDIRPGLIPQAPGPRFPLIQPGIPPQRGIPPPSVLDSALHPPPRGPFPPGDIFSQPERPFLAPGRQSVDNVT NPEKRIPLGNDNIQQEGDRDYRFPPIETRESISRPPPVDVRDVVGRPIDPREGPGRPPLDGRDHFGRPPVDIREN LVRPGIDHLGRRDHFGFNPEKPWGHRGDFDEREHRVLPVYGGPKGLHEERGRFRSGNYRFDPRSGPWNRGFGQEV HRDFDDRRRPWERQRDRDDRDFDFCREMNG
Stability : Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Shipping : The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.
Gene Name : SCAF8 SR-related CTD-associated factor 8 [ Homo sapiens ]
Official Symbol : SCAF8
Synonyms : SCAF8; SR-related CTD-associated factor 8; RBM16, RNA binding motif protein 16; protein SCAF8; KIAA1116; RNA-binding protein 16; RNA binding motif protein 16; RNA-binding motif protein 16; SR-like CTD-associated factor 8; putative RNA-binding protein 16; CDC5L complex-associated protein 7; SR-related and CTD-associated factor 8; RBM16;
Gene ID : 22828
mRNA Refseq : NM_014892
Protein Refseq : NP_055707
MIM : 616024
UniProt ID : Q9UPN6
Chromosome Location : 6q25.1-q25.3
Function : RNA binding; RNA polymerase core enzyme binding; nucleotide binding; protein domain specific binding;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy