Recombinant Human RBM16 protein, His-tagged

Cat.No. : RBM16-2209H
Product Overview : Recombinant Human RBM16 (921-1271aa) fussed with His tag at N-terminal was expressed in E. coli.
Availability May 21, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 921-1271aa
Form : 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), added with 300 mM Imidazole and 0.7% sarcosyl, 15% glycerol.
Molecular Mass : 44 kDa
AA Sequence : MPMLDIRPGLIPQAPGPRFPLIQPGIPPQRGIPPPSVLDSALHPPPRGPFPPGDIFSQPERPFLAPGRQSVDNVT NPEKRIPLGNDNIQQEGDRDYRFPPIETRESISRPPPVDVRDVVGRPIDPREGPGRPPLDGRDHFGRPPVDIREN LVRPGIDHLGRRDHFGFNPEKPWGHRGDFDEREHRVLPVYGGPKGLHEERGRFRSGNYRFDPRSGPWNRGFGQEV HRDFDDRRRPWERQRDRDDRDFDFCREMNG
Stability : Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Shipping : The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.
Gene Name SCAF8 SR-related CTD-associated factor 8 [ Homo sapiens ]
Official Symbol SCAF8
Synonyms SCAF8; SR-related CTD-associated factor 8; RBM16, RNA binding motif protein 16; protein SCAF8; KIAA1116; RNA-binding protein 16; RNA binding motif protein 16; RNA-binding motif protein 16; SR-like CTD-associated factor 8; putative RNA-binding protein 16; CDC5L complex-associated protein 7; SR-related and CTD-associated factor 8; RBM16;
Gene ID 22828
mRNA Refseq NM_014892
Protein Refseq NP_055707
MIM 616024
UniProt ID Q9UPN6
Chromosome Location 6q25.1-q25.3
Function RNA binding; RNA polymerase core enzyme binding; nucleotide binding; protein domain specific binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SCAF8 Products

Required fields are marked with *

My Review for All SCAF8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon