Recombinant Human RBM16 protein, His-tagged
| Cat.No. : | RBM16-2209H |
| Product Overview : | Recombinant Human RBM16 (921-1271aa) fussed with His tag at N-terminal was expressed in E. coli. |
| Availability | December 22, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 921-1271aa |
| Form : | 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), added with 300 mM Imidazole and 0.7% sarcosyl, 15% glycerol. |
| Molecular Mass : | 44 kDa |
| AA Sequence : | MPMLDIRPGLIPQAPGPRFPLIQPGIPPQRGIPPPSVLDSALHPPPRGPFPPGDIFSQPERPFLAPGRQSVDNVT NPEKRIPLGNDNIQQEGDRDYRFPPIETRESISRPPPVDVRDVVGRPIDPREGPGRPPLDGRDHFGRPPVDIREN LVRPGIDHLGRRDHFGFNPEKPWGHRGDFDEREHRVLPVYGGPKGLHEERGRFRSGNYRFDPRSGPWNRGFGQEV HRDFDDRRRPWERQRDRDDRDFDFCREMNG |
| Stability : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
| Shipping : | The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade. |
| Gene Name | SCAF8 SR-related CTD-associated factor 8 [ Homo sapiens ] |
| Official Symbol | SCAF8 |
| Synonyms | SCAF8; SR-related CTD-associated factor 8; RBM16, RNA binding motif protein 16; protein SCAF8; KIAA1116; RNA-binding protein 16; RNA binding motif protein 16; RNA-binding motif protein 16; SR-like CTD-associated factor 8; putative RNA-binding protein 16; CDC5L complex-associated protein 7; SR-related and CTD-associated factor 8; RBM16; |
| Gene ID | 22828 |
| mRNA Refseq | NM_014892 |
| Protein Refseq | NP_055707 |
| MIM | 616024 |
| UniProt ID | Q9UPN6 |
| Chromosome Location | 6q25.1-q25.3 |
| Function | RNA binding; RNA polymerase core enzyme binding; nucleotide binding; protein domain specific binding; |
| ◆ Recombinant Proteins | ||
| SCAF8-5238R | Recombinant Rat SCAF8 Protein | +Inquiry |
| SCAF8-7919M | Recombinant Mouse SCAF8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SCAF8-14705M | Recombinant Mouse SCAF8 Protein | +Inquiry |
| RBM16-2209H | Recombinant Human RBM16 protein, His-tagged | +Inquiry |
| SCAF8-4897R | Recombinant Rat SCAF8 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCAF8 Products
Required fields are marked with *
My Review for All SCAF8 Products
Required fields are marked with *
