Recombinant Human RBM16 protein, His-tagged
Cat.No. : | RBM16-2209H |
Product Overview : | Recombinant Human RBM16 (921-1271aa) fussed with His tag at N-terminal was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 921-1271aa |
Form : | 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), added with 300 mM Imidazole and 0.7% sarcosyl, 15% glycerol. |
Molecular Mass : | 44 kDa |
AA Sequence : | MPMLDIRPGLIPQAPGPRFPLIQPGIPPQRGIPPPSVLDSALHPPPRGPFPPGDIFSQPERPFLAPGRQSVDNVT NPEKRIPLGNDNIQQEGDRDYRFPPIETRESISRPPPVDVRDVVGRPIDPREGPGRPPLDGRDHFGRPPVDIREN LVRPGIDHLGRRDHFGFNPEKPWGHRGDFDEREHRVLPVYGGPKGLHEERGRFRSGNYRFDPRSGPWNRGFGQEV HRDFDDRRRPWERQRDRDDRDFDFCREMNG |
Stability : | Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles. |
Shipping : | The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade. |
Gene Name | SCAF8 SR-related CTD-associated factor 8 [ Homo sapiens ] |
Official Symbol | SCAF8 |
Synonyms | SCAF8; SR-related CTD-associated factor 8; RBM16, RNA binding motif protein 16; protein SCAF8; KIAA1116; RNA-binding protein 16; RNA binding motif protein 16; RNA-binding motif protein 16; SR-like CTD-associated factor 8; putative RNA-binding protein 16; CDC5L complex-associated protein 7; SR-related and CTD-associated factor 8; RBM16; |
Gene ID | 22828 |
mRNA Refseq | NM_014892 |
Protein Refseq | NP_055707 |
MIM | 616024 |
UniProt ID | Q9UPN6 |
Chromosome Location | 6q25.1-q25.3 |
Function | RNA binding; RNA polymerase core enzyme binding; nucleotide binding; protein domain specific binding; |
◆ Recombinant Proteins | ||
SCAF8-4897R | Recombinant Rat SCAF8 Protein, His (Fc)-Avi-tagged | +Inquiry |
RBM16-2209H | Recombinant Human RBM16 protein, His-tagged | +Inquiry |
SCAF8-14705M | Recombinant Mouse SCAF8 Protein | +Inquiry |
SCAF8-5238R | Recombinant Rat SCAF8 Protein | +Inquiry |
SCAF8-7919M | Recombinant Mouse SCAF8 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SCAF8 Products
Required fields are marked with *
My Review for All SCAF8 Products
Required fields are marked with *
0
Inquiry Basket