Recombinant Human RBM16 protein, His-tagged

• Cat.No.: RBM16-2209H
• Product Overview: Recombinant Human RBM16 (921-1271aa) fussed with His tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 921-1271aa
• Form: 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), added with 300 mM Imidazole and 0.7% sarcosyl, 15% glycerol.
• Molecular Mass: 44 kDa
• AA Sequence: MPMLDIRPGLIPQAPGPRFPLIQPGIPPQRGIPPPSVLDSALHPPPRGPFPPGDIFSQPERPFLAPGRQSVDNVT NPEKRIPLGNDNIQQEGDRDYRFPPIETRESISRPPPVDVRDVVGRPIDPREGPGRPPLDGRDHFGRPPVDIREN LVRPGIDHLGRRDHFGFNPEKPWGHRGDFDEREHRVLPVYGGPKGLHEERGRFRSGNYRFDPRSGPWNRGFGQEV HRDFDDRRRPWERQRDRDDRDFDFCREMNG
• Stability: Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
• Shipping: The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.

Gene Information

• Gene Name: SCAF8 SR-related CTD-associated factor 8 [ Homo sapiens ]
• Official Symbol: SCAF8
• Synonyms: SCAF8; SR-related CTD-associated factor 8; RBM16, RNA binding motif protein 16; protein SCAF8; KIAA1116; RNA-binding protein 16; RNA binding motif protein 16; RNA-binding motif protein 16; SR-like CTD-associated factor 8; putative RNA-binding protein 16; CDC5L complex-associated protein 7; SR-related and CTD-associated factor 8; RBM16
• Gene ID: 22828
• mRNA Refseq: NM_014892
• Protein Refseq: NP_055707
• MIM: 616024
• UniProt ID: Q9UPN6
• Chromosome Location: 6q25.1-q25.3
• Function: RNA binding; RNA polymerase core enzyme binding; nucleotide binding; protein domain specific binding