Recombinant Human SEC61G Full Length protein, GST-tagged

• Cat.No.: SEC61G-2568H
• Product Overview: Recombinant Human Full Length SEC61G protein(1-68 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: N-GST
• Protein Length: 1-68 aa
• Tag: N-GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: MDQVMQFVEPSRQFVKDSIRLVKRCTKPDRKEFQKIAMATAIGFAIMGFIGFFVKLIHIPINNIIVGG

Gene Information

• Gene Name: SEC61G Sec61 gamma subunit [ Homo sapiens ]
• Official Symbol: SEC61G
• Synonyms: SEC61G; Sec61 gamma subunit; protein transport protein Sec61 subunit gamma; SSS1; protein transport protein SEC61 gamma subunit
• Gene ID: 23480
• mRNA Refseq: NM_001012456
• Protein Refseq: NP_001012474
• MIM: 609215
• UniProt ID: P60059