Recombinant Human STEAP1 protein, His-tagged
Cat.No. : | STEAP1-3000H |
Product Overview : | Recombinant Human STEAP1 protein(1-80 aa), fused with His tag, was expressed in E.coli. |
Availability | July 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-80 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAI |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | STEAP1 six transmembrane epithelial antigen of the prostate 1 [ Homo sapiens ] |
Official Symbol | STEAP1 |
Synonyms | STEAP1; six transmembrane epithelial antigen of the prostate 1; six transmembrane epithelial antigen of the prostate , STEAP; metalloreductase STEAP1; PRSS24; six-transmembrane epithelial antigen of prostate 1; STEAP; MGC19484; |
Gene ID | 26872 |
mRNA Refseq | NM_012449 |
Protein Refseq | NP_036581 |
MIM | 604415 |
UniProt ID | Q9UHE8 |
◆ Recombinant Proteins | ||
RFL9628SF | Recombinant Full Length Pig Metalloreductase Steap1(Steap1) Protein, His-Tagged | +Inquiry |
Steap1-6177M | Recombinant Mouse Steap1 Protein, Myc/DDK-tagged | +Inquiry |
STEAP1-5801H | Recombinant Human STEAP1 Protein (Met1-His72), N-GST tagged | +Inquiry |
STEAP1-297H | Active Recombinant Human STEAP1 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
STEAP1-574H | Active Recombinant Human STEAP1 protein, His-tagged(Detergent) | +Inquiry |
◆ Cell & Tissue Lysates | ||
STEAP1-1710HCL | Recombinant Human STEAP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STEAP1 Products
Required fields are marked with *
My Review for All STEAP1 Products
Required fields are marked with *