Recombinant Human STEAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | STEAP1-3928H |
Product Overview : | STEAP1 MS Standard C13 and N15-labeled recombinant protein (NP_036581) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene is predominantly expressed in prostate tissue, and is found to be upregulated in multiple cancer cell lines. The gene product is predicted to be a six-transmembrane protein, and was shown to be a cell surface antigen significantly expressed at cell-cell junctions. |
Molecular Mass : | 39.9 kDa |
AA Sequence : | MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | STEAP1 six transmembrane epithelial antigen of the prostate 1 [ Homo sapiens (human) ] |
Official Symbol | STEAP1 |
Synonyms | STEAP1; six transmembrane epithelial antigen of the prostate 1; six transmembrane epithelial antigen of the prostate, STEAP; metalloreductase STEAP1; PRSS24; six-transmembrane epithelial antigen of prostate 1; STEAP; MGC19484; |
Gene ID | 26872 |
mRNA Refseq | NM_012449 |
Protein Refseq | NP_036581 |
MIM | 604415 |
UniProt ID | Q9UHE8 |
◆ Recombinant Proteins | ||
STEAP1-3000H | Recombinant Human STEAP1 protein, His-tagged | +Inquiry |
Steap1-6177M | Recombinant Mouse Steap1 Protein, Myc/DDK-tagged | +Inquiry |
STEAP1-5801H | Recombinant Human STEAP1 Protein (Met1-His72), N-GST tagged | +Inquiry |
RFL3571HF | Recombinant Full Length Human Metalloreductase Steap1(Steap1) Protein, His-Tagged | +Inquiry |
STEAP1-5281H | Recombinant Human STEAP1 protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STEAP1-1710HCL | Recombinant Human STEAP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All STEAP1 Products
Required fields are marked with *
My Review for All STEAP1 Products
Required fields are marked with *