Recombinant Human STEAP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: STEAP1-3928H
• Product Overview: STEAP1 MS Standard C13 and N15-labeled recombinant protein (NP_036581) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene is predominantly expressed in prostate tissue, and is found to be upregulated in multiple cancer cell lines. The gene product is predicted to be a six-transmembrane protein, and was shown to be a cell surface antigen significantly expressed at cell-cell junctions.
• Molecular Mass: 39.9 kDa
• AA Sequence: MESRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFPQWHLPIKIAAIIASLTFLYTLLREVIHPLATSHQQYFYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLDKWMLTRKQFGLLSFFFAVLHAIYSLSYPMRRSYRYKLLNWAYQQVQQNKEDAWIEHDVWRMEIYVSLGIVGLAILALLAVTSIPSVSDSLTWREFHYIQSKLGIVSLLLGTIHALIFAWNKWIDIKQFVWYTPPTFMIAVFLPIVVLIFKSILFLPCLRKKILKIRHGWEDVTKINKTEICSQLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: STEAP1 six transmembrane epithelial antigen of the prostate 1 [ Homo sapiens (human) ]
• Official Symbol: STEAP1
• Synonyms: STEAP1; six transmembrane epithelial antigen of the prostate 1; six transmembrane epithelial antigen of the prostate, STEAP; metalloreductase STEAP1; PRSS24; six-transmembrane epithelial antigen of prostate 1; STEAP; MGC19484
• Gene ID: 26872
• mRNA Refseq: NM_012449
• Protein Refseq: NP_036581
• MIM: 604415
• UniProt ID: Q9UHE8