Recombinant Human TNFAIP8 protein, His-tagged

• Cat.No.: TNFAIP8-3316H
• Product Overview: Recombinant Human TNFAIP8 protein(1-198 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-198 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: MHSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: TNFAIP8 tumor necrosis factor, alpha-induced protein 8 [ Homo sapiens ]
• Official Symbol: TNFAIP8
• Synonyms: TNFAIP8; tumor necrosis factor, alpha-induced protein 8; tumor necrosis factor alpha-induced protein 8; GG2 1; MDC 3.13; SCC S2; NDED; TNF-induced protein GG2-1; TNF alpha-induced protein 8; NF-kappa-B-inducible DED-containing protein; head and neck tumor and metastasis-related protein; GG2-1; SCCS2; SCC-S2; MDC-3.13
• Gene ID: 25816
• mRNA Refseq: NM_001077654
• Protein Refseq: NP_001071122
• MIM: 612111
• UniProt ID: O95379