Recombinant Human UNC5C protein, GST-tagged
Cat.No. : | UNC5C-3599H |
Product Overview : | Recombinant Human UNC5C protein(492-597 aa), fused with N-terminal GST tag, was expressed in E.coli. |
Availability | October 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 492-597 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
AASequence : | PLPNLKIKVYNTSGAVTPQDDLSEFTSKLSPQMTQSLLENEALSLKNQSLARQTDPSCTAFGSFNSLGGHLIVPNSGVSLLIPAGAIPQGRVYEMYVTVHRKETMR |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | UNC5C unc-5 homolog C (C. elegans) [ Homo sapiens ] |
Official Symbol | UNC5C |
Synonyms | UNC5C; unc-5 homolog C (C. elegans); unc5 (C.elegans homolog) c; netrin receptor UNC5C; unc-5 homolog 3; protein unc-5 homolog 3; protein unc-5 homolog C; UNC5H3; |
Gene ID | 8633 |
mRNA Refseq | NM_003728 |
Protein Refseq | NP_003719 |
MIM | 603610 |
UniProt ID | O95185 |
◆ Recombinant Proteins | ||
UNC5C-674H | Recombinant Human UNC5C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
UNC5C-5796Z | Recombinant Zebrafish UNC5C | +Inquiry |
UNC5C-6021C | Recombinant Chicken UNC5C | +Inquiry |
UNC5C-633H | Recombinant Human UNC5C Protein, MYC/DDK-tagged | +Inquiry |
UNC5C-17849M | Recombinant Mouse UNC5C Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All UNC5C Products
Required fields are marked with *
My Review for All UNC5C Products
Required fields are marked with *