Recombinant Mouse HAO1, without tag
| Cat.No. : | HAO1-839M |
| Product Overview : | Recombinant Mouse Hydroxyacid oxidase 1 (HAOX1) (a.a.1-370) was expressed in E.coli with no tag. |
| Availability | December 03, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 1-370 a.a. |
| Form : | Liquid |
| Molecular Mass : | Theoretical molecular weight: ~41kDa |
| AA Sequence : | MLPRLVCISDYEQHVRSVLQKSVYDYYRSGANDQETLADNIQAFSRWKLYPRMLRNVADIDLSTSVLGQRVSMPI CVGATAMQCMAHVDGELATVRACQTMGTGMMLSSWATSSIEEVAEAGPEALRWMQLYIYKDREISRQIVKRAEKQ GYKAIFVTVDTPYLGNRIDDVRNRFKLPPQLRMKNFETNDLAFSPKGNFGDNSGLAEYVAQAIDPSLSWDDITWL RRLTSLPIVVKGILRGDDAKEAVKHGVDGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV LKALALGAKAVFVGRPIIWGLAFQGEKGVQDVLEILKEEFRLAMALSGCQNVKVIDKTLVRKNPLAVSKI |
| Purity : | > 95% as determined by SDS-PAGE. |
| Storage : | Short Term Storage +4°C, Long Term Storage -20°C. Prepare aliquots and store at -20°C. Avoid freeze/thaw cycles. |
| Concentration : | 2.5mg/ml |
| Storage Buffer : | 20mM Tris-HCl, pH8.0, 200mM NaCl, 10% Glycerol. |
| Gene Name | Hao1 hydroxyacid oxidase 1, liver [ Mus musculus ] |
| Official Symbol | HAO1 |
| Synonyms | HAO1; hydroxyacid oxidase 1, liver; hydroxyacid oxidase 1; HAOX1; glycolate oxidase 1; GOX; Gox1; Hao-1; MGC141211; |
| Gene ID | 15112 |
| mRNA Refseq | NM_010403 |
| Protein Refseq | NP_034533 |
| Pathway | Glyoxylate and dicarboxylate metabolism, organism-specific biosystem; Glyoxylate and dicarboxylate metabolism, conserved biosystem; Glyoxylate metabolism, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; Peroxisome, organism-specific biosystem; |
| Function | (S)-2-hydroxy-acid oxidase activity; (S)-2-hydroxy-acid oxidase activity; FMN binding; catalytic activity; glycolate oxidase activity; long-chain-(S)-2-hydroxy-long-chain-acid oxidase activity; medium-chain-(S)-2-hydroxy-acid oxidase activity; oxidoreductase activity; very-long-chain-(S)-2-hydroxy-acid oxidase activity; |
| ◆ Recombinant Proteins | ||
| HAO1-3820H | Recombinant Human HAO1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| HAO1-3795H | Recombinant Human HAO1, His tagged | +Inquiry |
| HAO1-4570H | Recombinant Human HAO1 Protein, GST-tagged | +Inquiry |
| HAO1-99H | Recombinant Human HAO1, TraxA/His-tagged | +Inquiry |
| HAO1-5403Z | Recombinant Zebrafish HAO1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HAO1-5638HCL | Recombinant Human HAO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HAO1 Products
Required fields are marked with *
My Review for All HAO1 Products
Required fields are marked with *
