"LAG3" Related Products

Expand
Expand
Expand

Recombinant Human LAG3, GST-tagged

Cat.No.: LAG3-103H
Product Overview: Recombinant Human LAG3(1 a.a. - 360 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: Lymphocyte-activation protein 3 belongs to Ig superfamily and contains 4 extracellular Ig-like domains. The LAG3 gene contains 8 exons. The sequence data, exon/intron organization, and chromosomal localization all indicate a close relationship of LAG3 to CD4.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 65.5 kDa
AA Sequence: MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAA PGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRP ARRADAGEYRAA VHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASV HWFRNRGQGRVPVRESPHHHLAESF LFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGL EPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTP PGGGPDLLVTGDNGDFTLRLEDVS QAQAGTYTCHIHLQEQQLNATVTLAIITGQPQVGKE
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: LAG3 lymphocyte-activation gene3 [ Homo sapiens ]
Official Symbol: LAG3
Synonyms: LAG3; lymphocyte-activationgene 3; CD223; lymphocyte activation gene 3 protein; Protein FDC; FDC;OTTHUMP00000240397; LAG-3
Gene ID: 3902
mRNA Refseq: NM_002286
Protein Refseq: NP_002277
MIM: 153337
UniProt ID: P18627
Chromosome Location: 12p13.32
Function: MHC class II proteinbinding; antigen binding; transmembrane signaling receptor activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.