| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
207 |
| Description : |
Fibroblast growth factor-9 (FGF-9) is a member of the fibroblast growth factor (FGF) family. All FGF family members are heparin binding growth factors with a core 120 amino acid (a.a.) FGF domain that allows for a common tertiary structure. FGF-9 plays an important role in the regulation of embryonic development, cell proliferation, cell differentiation and cell migration. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. FGF-9 is a monomer and interacts with FGFR1, FGFR2, FGFR3 and FGFR4. The human FGF-9 shares 98 % a.a. sequence identity with mouse, rat, equine, porcine, and bovine FGF-9. |
| Form : |
Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
| Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 ng/ml, corresponding to a specific activity of > 2.0 × 10⁶ IU/mg. |
| Molecular Mass : |
Approximately 23.3 kDa, a single non-glycosylated polypeptide chain containing 207 amino acids. |
| AA Sequence : |
APLGEVGNYFGVQDAVPFGNVPVLPVDSPVLLSDHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLYCRTGFHLEIFPNGTIQGTRKDHSRFGILEFISIAVGLVSIRGVDSGLYLGMNEKGELYGSEKLTQECVFREQFEENWYNTYSSNLYKHVDTGRRYYVALNKDGTPREGTRTKRHQKFTHFLPRPVDPDKVPELYKDILSQS |
| Endotoxin : |
Less than 1 EU/µg of rHuFGF-9 as determined by LAL method. |
| Purity : |
>95% by SDS-PAGE and HPLC analysis. |
| Storage : |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
| Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in 1 × PBS to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
