Recombinant Human MASP1, GST-tagged
Cat.No. : | MASP1-755H |
Product Overview : | Recombinant Human MASP1(1 a.a. - 380 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a serine protease that functions as a component of the lectin pathway of complement activation. The complement pathway plays an essential role in the innate and adaptive immune response. The encoded protein is synthesized as a zymogen and is activated when it complexes with the pathogen recognition molecules of lectin pathway, the mannose-binding lectin and the ficolins. This protein is not directly involved in complement activation but may play a role as an amplifier of complement activation by cleaving complement C2 or by activating another complement serine protease, MASP-2. The encoded protein is also able to cleave fibrinogen and factor XIII and may may be involved in coagulation. A splice variant of this gene which lacks the serine protease domain functions as an inhibitor of the complement pathway. Alternate splicing results in multiple transcript variants. |
Molecular Mass : | 70 kDa |
AA Sequence : | MRWLLLYYALCFSLSKASAHTVELNNMFGQIQSPGYPDSYPSDSEVTWNITVPDGFRIKLYFMHFNLESSYLCEY DYVKVETEDQVLATFCGRETTDTEQTPGQEVVLSPGSFMSITFRSDFSNEERFTGFDAHYMAVDVDECKEREDEE LSCDHYCHNYIGGYYCSCRFGYILHTDNRTCRVECSDNLFTQRTGVITSPDFPNPYPKSSECLYTIELEEGFMVN LQFEDIFDIEDHPEVPCPYDYIKIKVGPKVLGPFCGEKAPEPISTQSHSVLILFHSDNSGENRGWRLSYRAAGNE CPELQPPVHGKIEPSQAKYFFKDQVLVSCDTGYKVLKDNVEMDTFQIECLKDGTWSNKIPTCKKNEIDLESELKS EQVTE |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MASP1 mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor) [ Homo sapiens (human) ] |
Official Symbol | MASP1 |
Synonyms | MASP1; 3MC1; MAP1; MASP; RaRF; CRARF; MASP3; MAp44; PRSS5; CRARF1; mannan-binding lectin serine peptidase 1 (C4/C2 activating component of Ra-reactive factor); mannan-binding lectin serine protease 1; serine protease 5; complement factor MASP-3; Ra-reactive factor serine protease p100; mannose-binding protein-associated serine protease; mannose-binding lectin-associated serine protease 1; complement-activating component of Ra-reactive factor; EC 3.4.21.- |
Gene ID | 5648 |
mRNA Refseq | NM_001031849 |
Protein Refseq | NP_001027019 |
MIM | 600521 |
UniProt ID | P48740 |
Chromosome Location | 3q27-q28 |
Pathway | Binding and Uptake of Ligands by Scavenger Receptors; Complement Activation; Complement and coagulation cascades |
Function | calcium ion binding; calcium-dependent protein binding; peptidase activity |
◆ Recombinant Proteins | ||
Masp1-3966M | Recombinant Mouse Masp1 Protein, Myc/DDK-tagged | +Inquiry |
MASP1-138H | Active Recombinant Human MASP1 protein, His-tagged | +Inquiry |
Masp1-1943M | Recombinant Mouse Masp1 protein, His-tagged | +Inquiry |
MASP1-4869H | Recombinant Human MASP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MASP1-3248R | Recombinant Rat MASP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MASP1-4460HCL | Recombinant Human MASP1 293 Cell Lysate | +Inquiry |
MASP1-4461HCL | Recombinant Human MASP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MASP1 Products
Required fields are marked with *
My Review for All MASP1 Products
Required fields are marked with *