Recombinant Human CXCR4

Cat.No. : CXCR4-504H
Product Overview : Recombinant Human CXCR4 was expressed in wheat germ.
Availability September 08, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Citation
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : This gene encodes a CXC chemokine receptor specific for stromal cell-derived factor-1. The protein has 7 transmembrane regions and is located on the cell surface. It acts with the CD4 protein to support HIV entry into cells and is also highly expressed in breast cancer cells. Mutations in this gene have been associated with WHIM (warts, hypogammaglobulinemia, infections, and myelokathexis) syndrome. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Form : Liquid
Molecular Mass : 39.7 kDa
AA Sequence : MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVILVMGYQKKLRSMTDK YRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNLYSSVLILAFISLDRYLAIVHATNSQRPRKL LAEKVVYVGVWIPALLLTIPDFIFANVSEADDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISK LSHSKGHQKRKALKTTVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
Applications : Antibody Production; Functional Study; Compound Screening
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH 8.0 containing 2% glycerol.
Publications :
The development and characterization of SDF1α-elastin-like-peptide nanoparticles for wound healing (2016)
Gene Name CXCR4 chemokine (C-X-C motif) receptor 4 [ Homo sapiens ]
Official Symbol CXCR4
Synonyms CXCR4; chemokine (C-X-C motif) receptor 4; chemokine (C X C motif), receptor 4 (fusin); C-X-C chemokine receptor type 4; CD184; D2S201E; fusin; HM89; HSY3RR; LESTR; NPY3R; NPYR; NPYY3R; CXC-R4; CXCR-4; CD184 antigen; SDF-1 receptor; neuropeptide Y receptor Y3; seven transmembrane helix receptor; stromal cell-derived factor 1 receptor; lipopolysaccharide-associated protein 3; seven-transmembrane-segment receptor, spleen; leukocyte-derived seven transmembrane domain receptor; leukocyte-derived seven-transmembrane-domain receptor; FB22; LAP3; LCR1; WHIM; NPYRL
Gene ID 7852
mRNA Refseq NM_001008540
Protein Refseq NP_001008540
MIM 162643
UniProt ID P61073
Chromosome Location 2q21
Pathway Axon guidance; Cardiac Progenitor Differentiation; Class A/1 (Rhodopsin-like receptors)
Function C-X-C chemokine receptor activity; G-protein coupled receptor activity; myosin light chain binding

The development and characterization of SDF1α-elastin-like-peptide nanoparticles for wound healing

Journal: Journal of controlled release : official journal of the Controlled Release Society    PubMed ID: 27094603    Data: 2017/6/28

Authors: Agnes Yeboah, Rick I. Cohen, Francois Berthiaume

Article Snippet:The chip temperature was set to 37°C.The chip temperature was set to 37°C.. Kinetic experiments were done with 5 different concentrations of recombinant human CXCR4 (Creative BioMart) diluted in PBS (0.74nM to 60nM).. Sensograms obtained for SDF1-ELP and SDF1 were subtracted from the reference channel signal and the curves were fitted to a one-site interaction model using the Biacore T200 software.Sensograms obtained for SDF1-ELP and SDF1 were subtracted from the reference channel signal and the curves were fitted to a one-site interaction model using the Biacore T200 software.

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCR4 Products

Required fields are marked with *

My Review for All CXCR4 Products

Required fields are marked with *

0
cart-icon