"UGT3A1" Related Products

Expand

Recombinant Human UGT3A1, GST-tagged

Cat.No.: UGT3A1-3590H
Product Overview: Recombinant Human UGT3A1(1 a.a. - 523 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 85.6 kDa
AA Sequence: MVGQRVLLLVAFLLSGVLLSEAAKILTISTLGGSHYLLLDRVSQILQEHGHNVTMLHQSGKFLIPDIKEEEKSYQ VIRWFSPEDHQKRIKKHFDSYIETALDGRKESEALVKLMEIFGTQCSYLLSRKDIMDSLKNENYDLVFVEAFDFC SFLIAEKLVKPFVAILPTTFGSLDFGLPSPLSYVPVFPSLLTDHMDFWGRVKNFLMFFSFSRSQWDMQSTFDNTI KEHFPEGSRPVLSHLLLKAELWFVNSDFAFDFARPLLPNTVYIGGLMEKPIKPVPQDLDNFIANFGDAGFVLVAF GSMLNTHQSQEVLKKMHNAFAHLPQGVIWTCQSSHWPRDVHLATNVKIVDWLPQSDLLAHPSIRLFVTHGGQNSV MEAIRHGVPMVGLPVNGDQHGNMVRVVAKNYGVSIRLNQVTADTLTLTMKQVIEDKRYKSAVVAASVILHSQPLS PAQRLVGWIDHILQTGGATHLKPYAFQQPWHEQYLIDVFVFLLGLTLGTMWLCGKLLGVVARWLRGARKVKKT
Applications: ELISA; WB-Re; AP; Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: UGT3A1 UDP glycosyltransferase 3 family, polypeptide A1 [ Homo sapiens ]
Official Symbol: UGT3A1
Synonyms: UGT3A1; UDP glycosyltransferase 3 family, polypeptide A1; UDP-glucuronosyltransferase 3A1; FLJ34658; UDPGT 3A1; FLJ26528; EC 2.4.1.17; NP_001165344.1; NP_689617.3
Gene ID: 133688
mRNA Refseq: NM_001171873
Protein Refseq: NP_001165344
UniProt ID: Q6NUS8
Chromosome Location: 5p13.2
Function: UDP-glycosyltransferase activity; glucuronosyltransferase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.