Recombinant Human Activin A Receptor, Type I

Cat.No. : ACVR1-01H
Product Overview : Recombinant Human Activin A Receptor, Type I was expressed in sf9.
Availability November 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Sf9 Cells
Tag : Non
Description : Human Activin A is a 26.0 kDa disulfide-linked homodimer of two βA chains, each containing 116 amino acid residues, belonging to the TGF-β family. It exhibits a wide range of biological activity including regulation of cellular proliferation and differentiation, and promotion of neuronal survival. Elevated levels of Activin A in human colorectal tumors and in postmenopausal women have been implicated in colorectal and breast cancers, respectively. The biological activities of Activin A can be neutralized by inhibins and by the diffusible TGF-β antagonist, follistatin.
Form : Liquid
Molecular Mass : The secreted recombinant human ALK2 consists of 123 amino acids and has a calculated molecular mass of 13.5KDa. It migrates as an approximately 17kDa band in SDS-PAGE under reducing conditions.
AA Sequence : MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYE QGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLE
Purity : >93% as determined by SDS-PAGE.
Storage : Store it at +4°C for short term. For long term storage, store it at -20°C ~ -70°C.
Storage Buffer : 25 mM Tris-HCl, pH7.4, 300 mM NaCl ,1 mM DTT, 5% Trehalose.
Publications :
An anti-ACVR1 antibody exacerbates heterotopic ossification by fibro-adipogenic progenitors in fibrodysplasia ossificans progressiva mice (2022)
Gene Name ACVR1 activin A receptor, type I [ Homo sapiens ]
Official Symbol ACVR1
Synonyms ACVR1; activin A receptor, type I; ACVRLK2; activin receptor type-1; ACVR1A; ALK2; SKR1; activin receptor type I; hydroxyalkyl-protein kinase; activin receptor-like kinase 2; TGF-B superfamily receptor type I; activin A receptor, type II-like kinase 2; serine/threonine-protein kinase receptor R1; FOP; TSRI; ACTRI;
Gene ID 90
mRNA Refseq NM_001105
Protein Refseq NP_001096
MIM 102576
UniProt ID Q04771
Chromosome Location 2q23-q24
Pathway ALK1 pathway, organism-specific biosystem; ALK1 signaling events, organism-specific biosystem; ALK2 signaling events, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem;
Function ATP binding; SMAD binding; activin binding; contributes_to activin receptor activity, type I; follistatin binding; metal ion binding; nucleotide binding; protein binding; protein homodimerization activity; protein serine/threonine kinase activity; receptor activity; receptor signaling protein serine/threonine kinase activity; transforming growth factor beta binding; transforming growth factor beta receptor activity, type I; transmembrane receptor protein serine/threonine kinase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACVR1 Products

Required fields are marked with *

My Review for All ACVR1 Products

Required fields are marked with *

0
cart-icon
0
compare icon