Recombinant Human Activin A Receptor, Type I
| Cat.No. : | ACVR1-01H |
| Product Overview : | Recombinant Human Activin A Receptor, Type I was expressed in sf9. |
| Availability | May 24, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Sf9 Cells |
| Tag : | Non |
| Description : | Human Activin A is a 26.0 kDa disulfide-linked homodimer of two βA chains, each containing 116 amino acid residues, belonging to the TGF-β family. It exhibits a wide range of biological activity including regulation of cellular proliferation and differentiation, and promotion of neuronal survival. Elevated levels of Activin A in human colorectal tumors and in postmenopausal women have been implicated in colorectal and breast cancers, respectively. The biological activities of Activin A can be neutralized by inhibins and by the diffusible TGF-β antagonist, follistatin. |
| Form : | Liquid |
| Molecular Mass : | The secreted recombinant human ALK2 consists of 123 amino acids and has a calculated molecular mass of 13.5KDa. It migrates as an approximately 17kDa band in SDS-PAGE under reducing conditions. |
| AA Sequence : | MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYE QGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLE |
| Purity : | >93% as determined by SDS-PAGE. |
| Storage : | Store it at +4°C for short term. For long term storage, store it at -20°C ~ -70°C. |
| Storage Buffer : | 25 mM Tris-HCl, pH7.4, 300 mM NaCl ,1 mM DTT, 5% Trehalose. |
| Publications : |
| Gene Name | ACVR1 activin A receptor, type I [ Homo sapiens ] |
| Official Symbol | ACVR1 |
| Synonyms | ACVR1; activin A receptor, type I; ACVRLK2; activin receptor type-1; ACVR1A; ALK2; SKR1; activin receptor type I; hydroxyalkyl-protein kinase; activin receptor-like kinase 2; TGF-B superfamily receptor type I; activin A receptor, type II-like kinase 2; serine/threonine-protein kinase receptor R1; FOP; TSRI; ACTRI; |
| Gene ID | 90 |
| mRNA Refseq | NM_001105 |
| Protein Refseq | NP_001096 |
| MIM | 102576 |
| UniProt ID | Q04771 |
| Chromosome Location | 2q23-q24 |
| Pathway | ALK1 pathway, organism-specific biosystem; ALK1 signaling events, organism-specific biosystem; ALK2 signaling events, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem; |
| Function | ATP binding; SMAD binding; activin binding; contributes_to activin receptor activity, type I; follistatin binding; metal ion binding; nucleotide binding; protein binding; protein homodimerization activity; protein serine/threonine kinase activity; receptor activity; receptor signaling protein serine/threonine kinase activity; transforming growth factor beta binding; transforming growth factor beta receptor activity, type I; transmembrane receptor protein serine/threonine kinase activity; |
| ◆ Recombinant Proteins | ||
| Acvr1-814M | Recombinant Mouse Acvr1 Protein, MYC/DDK-tagged | +Inquiry |
| ACVR1-5680H | Recombinant Human ACVR1 protein, His-tagged | +Inquiry |
| ACVR1-489H | Recombinant Human Activin A Receptor, Type I, Fc Chimera | +Inquiry |
| ACVR1-526H | Active Recombinant Human ACVR1, Fc-tagged, Biotinylated | +Inquiry |
| RFL-20406RF | Recombinant Full Length Rat Activin Receptor Type-1(Acvr1) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACVR1-1232CCL | Recombinant Cynomolgus ACVR1 cell lysate | +Inquiry |
| ACVR1-967CCL | Recombinant Canine ACVR1 cell lysate | +Inquiry |
| ACVR1-1305RCL | Recombinant Rat ACVR1 cell lysate | +Inquiry |
| ACVR1-3097HCL | Recombinant Human ACVR1 cell lysate | +Inquiry |
| ACVR1-478HCL | Recombinant Human ACVR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACVR1 Products
Required fields are marked with *
My Review for All ACVR1 Products
Required fields are marked with *
