Recombinant Human Activin A Receptor, Type I ACVR1-01H

Recombinant Human Activin A Receptor, Type I

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human Activin A Receptor, Type I

Recombinant Human Activin A Receptor, Type I

ACVR1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : ACVR1-01H
Product Overview : Recombinant Human Activin A Receptor, Type I was expressed in sf9.
Description : Human Activin A is a 26.0 kDa disulfide-linked homodimer of two βA chains, each containing 116 amino acid residues, belonging to the TGF-β family. It exhibits a wide range of biological activity including regulation of cellular proliferation and differentiation, and promotion of neuronal survival. Elevated levels of Activin A in human colorectal tumors and in postmenopausal women have been implicated in colorectal and breast cancers, respectively. The biological activities of Activin A can be neutralized by inhibins and by the diffusible TGF-β antagonist, follistatin.
Source : sf9
Species : Human
Form : Liquid
Molecular Mass : The secreted recombinant human ALK2 consists of 123 amino acids and has a calculated molecular mass of 13.5KDa. It migrates as an approximately 17kDa band in SDS-PAGE under reducing conditions.
AA Sequence : MVDGVMILPVLIMIALPSPSMEDEKPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSINDGFHVYQKGCFQVYE QGKMTCKTPPSPGQAVECCQGDWCNRNITAQLPTKGKSFPGTQNFHLE
Purity : >93% as determined by SDS-PAGE.
Storage : Store it at +4°C for short term. For long term storage, store it at -20°C ~ -70°C.
Storage Buffer : 25 mM Tris-HCl, pH7.4, 300 mM NaCl ,1 mM DTT, 5% Trehalose.
Gene Name : ACVR1 activin A receptor, type I [ Homo sapiens ]
Official Symbol : ACVR1
Synonyms : ACVR1; activin A receptor, type I; ACVRLK2; activin receptor type-1; ACVR1A; ALK2; SKR1; activin receptor type I; hydroxyalkyl-protein kinase; activin receptor-like kinase 2; TGF-B superfamily receptor type I; activin A receptor, type II-like kinase 2; serine/threonine-protein kinase receptor R1; FOP; TSRI; ACTRI;
Gene ID : 90
mRNA Refseq : NM_001105
Protein Refseq : NP_001096
MIM : 102576
UniProt ID : Q04771
Chromosome Location : 2q23-q24
Pathway : ALK1 pathway, organism-specific biosystem; ALK1 signaling events, organism-specific biosystem; ALK2 signaling events, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem;
Function : ATP binding; SMAD binding; activin binding; contributes_to activin receptor activity, type I; follistatin binding; metal ion binding; nucleotide binding; protein binding; protein homodimerization activity; protein serine/threonine kinase activity; receptor activity; receptor signaling protein serine/threonine kinase activity; transforming growth factor beta binding; transforming growth factor beta receptor activity, type I; transmembrane receptor protein serine/threonine kinase activity;

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy