Recombinant Full Length Rat Activin Receptor Type-1(Acvr1) Protein, His-Tagged
| Cat.No. : | RFL-20406RF |
| Product Overview : | Recombinant Full Length Rat Activin receptor type-1(Acvr1) Protein (P80201) (21-509aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (21-509) |
| Form : | Lyophilized powder |
| AA Sequence : | MEDEEPKVNPKLYMCVCEGLSCGNEDHCEGQQCFSSLSVNDGFRVYQKGCFQVYEQGKMTCKTPPSPGQAVECCQGDWCNRNVTARLPTKGKSFPGSQNFHLEVGLIILSVVFAVCLFACILGVALRKFKRRNQERLNPRDVEYGTIEGLITTNVGDSTLAELLDHSCTSGSGSGLPFLVQRTVARQITLLECVGKGRYGEVWRGSWQGENVAVKIFSSRDEKSWFRETELYNTVMLRHENILGFIASDMTSRHSSTQLWLITHYHEMGSLYDYLQLTTLDTVSCLRIVLSIASGLAHLHIEIFGTQGKSAIAHRDLKSKNILVKKNGQCCIADLGLAVMHSQSTNQLDVGNNPRVGTKRYMAPEVLDETIQVDCFDSYKRVDIWAFGLVLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Acvr1 |
| Synonyms | Acvr1; Acvrlk2; Activin receptor type-1; Activin receptor type I; ACTR-I; Serine/threonine-protein kinase receptor R1; SKR1; TGF-B superfamily receptor type I; TSR-I |
| UniProt ID | P80201 |
| ◆ Recombinant Proteins | ||
| ACVR1-4357H | Recombinant Human ACVR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Acvr1-775M | Active Recombinant Mouse Acvr1 protein(Met1-Glu123), His&hFc-tagged | +Inquiry |
| ACVR1-0495H | Recombinant Human ACVR1 Protein, Fc-tagged, 95% SEC-HPLC | +Inquiry |
| ACVR1-864HF | Recombinant Full Length Human ACVR1 Protein, GST-tagged | +Inquiry |
| ACVR1-527H | Active Recombinant Human ACVR1 Protein, His/Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACVR1-1305RCL | Recombinant Rat ACVR1 cell lysate | +Inquiry |
| ACVR1-3097HCL | Recombinant Human ACVR1 cell lysate | +Inquiry |
| ACVR1-967CCL | Recombinant Canine ACVR1 cell lysate | +Inquiry |
| ACVR1-1232CCL | Recombinant Cynomolgus ACVR1 cell lysate | +Inquiry |
| ACVR1-478HCL | Recombinant Human ACVR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Acvr1 Products
Required fields are marked with *
My Review for All Acvr1 Products
Required fields are marked with *



