Recombinant human EGLN1, GST tagged

• Cat.No.: EGLN1-126H
• Product Overview: Recombinant human EGLN1 full-length ORF ( AAH05369.1, 1 a.a. - 128 a.a.) was expressed in Wheat Germ, with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene catalyzes the post-translational formation of 4-hydroxyproline in hypoxia-inducible factor (HIF) alpha proteins. HIF is a transcriptional complex that plays a central role in mammalian oxygen homeostasis. This protein functions as a cellular oxygen sensor, and under normal oxygen concentration, modification by prolyl hydroxylation is a key regulatory event that targets HIF subunits for proteasomal destruction via the von Hippel-Lindau ubiquitylation complex. Mutations in this gene are associated with erythrocytosis familial type 3 (ECYT3).
• Form: Liquid
• Molecular Mass: 41 kDa
• AA Sequence: MVACYPGNGTGYVRHVDNPNGDGRCVTCIYYLNKDWDAKVSGGILRIFPEGKAQFADIEPKFDRLLFFWSDRRNP HEVQPAYATRYAITVWYFDADERARAKVKYLTGEKGVRVELNKPSDSVGKDVF
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: EGLN1 egl nine homolog 1 (C. elegans) [ Homo sapiens ]
• Official Symbol: EGLN1
• Synonyms: EGLN1; egl nine homolog 1 (C. elegans); C1orf12, EGL nine (C.elegans) homolog 1; egl nine homolog 1; HIF prolyl hydroxylase 2; HIFPH2; PHD2; SM 20; ZMYND6; egl nine-like protein 1; HIF-prolyl hydroxylase 2; zinc finger MYND domain-containing protein 6; hypoxia-inducible factor prolyl hydroxylase 2; prolyl hydroxylase domain-containing protein 2; HPH2; SM20; ECYT3; HPH-2; C1orf12; HIF-PH2; DKFZp761F179
• Gene ID: 54583
• mRNA Refseq: NM_022051
• Protein Refseq: NP_071334
• MIM: 606425
• UniProt ID: Q9GZT9
• Chromosome Location: 1q42.1
• Pathway: HIF-1-alpha transcription factor network, organism-specific biosystem; HIF-2-alpha transcription factor network, organism-specific biosystem; Pathways in cancer, organism-specific biosystem; Renal cell carcinoma, organism-specific biosystem; Renal cell carcinoma, conserved biosystem
• Function: L-ascorbic acid binding; iron ion binding; metal ion binding; oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen; peptidyl-proline dioxygenase activity; protein binding; zinc ion binding