"SF1" Related Products

Expand
Expand

Recombinant Human SF1, GST-tagged

Cat.No.: SF1-2609H
Product Overview: Recombinant Human SF1(1 a.a. - 548 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: This gene encodes a nuclear pre-mRNA splicing factor. The encoded protein specifically recognizes the intron branch point sequence and is required for the early stages of spliceosome assembly. Alternate splicing results in multiple transcript variants.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 86.02 kDa
AA Sequence: MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPN PEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEI NFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNI LKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDP QSAQDKARMDKEYLSLMAELGEAPVPASVGSTSGPATTPLASAPRPAAPANNPPPPSLMSTTQSRPPWMNSGPSE SRPYHGMHGGGPGGPGGGPHSFPHPLPSLTGGHGGHPMQHNPNGPPPPWMQPPPPPMNQGPHPPGHHGPPPMDQY LGSTPVGSGVYRLHQGKGMMPPPPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLPW QQRSLPAAAMARAMRVRTFRAHW
Applications: ELISA; WB-Re; AP; Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: SF1 splicing factor 1 [ Homo sapiens ]
Official Symbol: SF1
Synonyms: SF1; splicing factor 1; zinc finger protein 162 , ZNF162; ZFM1; zinc finger protein 162; transcription factor ZFM1; zinc finger gene in MEN1 locus; mammalian branch point-binding protein; BBP; MBBP; ZNF162; D11S636
Gene ID: 7536
mRNA Refseq: NM_201997
Protein Refseq: NP_973726
MIM: 601516
UniProt ID: Q15637
Chromosome Location: 11q13
Function: RNA binding; poly(A) RNA binding; transcription corepressor activity; zinc ion binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.