Recombinant Human SF1, GST-tagged
| Cat.No. : | SF1-2609H | 
| Product Overview : | Recombinant Human SF1(1 a.a. - 548 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | Wheat Germ | 
| Tag : | GST | 
| Description : | This gene encodes a nuclear pre-mRNA splicing factor. The encoded protein specifically recognizes the intron branch point sequence and is required for the early stages of spliceosome assembly. Alternate splicing results in multiple transcript variants. | 
| Molecular Mass : | 86.02 kDa | 
| AA Sequence : | MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPN PEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEI NFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNI LKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDP QSAQDKARMDKEYLSLMAELGEAPVPASVGSTSGPATTPLASAPRPAAPANNPPPPSLMSTTQSRPPWMNSGPSE SRPYHGMHGGGPGGPGGGPHSFPHPLPSLTGGHGGHPMQHNPNGPPPPWMQPPPPPMNQGPHPPGHHGPPPMDQY LGSTPVGSGVYRLHQGKGMMPPPPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLPW QQRSLPAAAMARAMRVRTFRAHW | 
| Applications : | ELISA; WB-Re; AP; Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | SF1 splicing factor 1 [ Homo sapiens ] | 
| Official Symbol | SF1 | 
| Synonyms | SF1; splicing factor 1; zinc finger protein 162 , ZNF162; ZFM1; zinc finger protein 162; transcription factor ZFM1; zinc finger gene in MEN1 locus; mammalian branch point-binding protein; BBP; MBBP; ZNF162; D11S636 | 
| Gene ID | 7536 | 
| mRNA Refseq | NM_201997 | 
| Protein Refseq | NP_973726 | 
| MIM | 601516 | 
| UniProt ID | Q15637 | 
| Chromosome Location | 11q13 | 
| Function | RNA binding; poly(A) RNA binding; transcription corepressor activity; zinc ion binding | 
| ◆ Recombinant Proteins | ||
| SF1-2610H | Recombinant Human SF1, GST-tagged | +Inquiry | 
| SF1-1707H | Recombinant Human SF1 protein, His & T7-tagged | +Inquiry | 
| SF1-2609H | Recombinant Human SF1, GST-tagged | +Inquiry | 
| Sf1-5807M | Recombinant Mouse Sf1 Protein, Myc/DDK-tagged | +Inquiry | 
| SF1-11929Z | Recombinant Zebrafish SF1 | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| SF1-1921HCL | Recombinant Human SF1 293 Cell Lysate | +Inquiry | 
| SF1-1922HCL | Recombinant Human SF1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SF1 Products
Required fields are marked with *
My Review for All SF1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            