Recombinant Human SF1, GST-tagged
| Cat.No. : | SF1-2609H |
| Product Overview : | Recombinant Human SF1(1 a.a. - 548 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a nuclear pre-mRNA splicing factor. The encoded protein specifically recognizes the intron branch point sequence and is required for the early stages of spliceosome assembly. Alternate splicing results in multiple transcript variants. |
| Molecular Mass : | 86.02 kDa |
| AA Sequence : | MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDLGIPPN PEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKVMIPQDEYPEI NFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNI LKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCTKCGGAGHIASDCKFQRPGDP QSAQDKARMDKEYLSLMAELGEAPVPASVGSTSGPATTPLASAPRPAAPANNPPPPSLMSTTQSRPPWMNSGPSE SRPYHGMHGGGPGGPGGGPHSFPHPLPSLTGGHGGHPMQHNPNGPPPPWMQPPPPPMNQGPHPPGHHGPPPMDQY LGSTPVGSGVYRLHQGKGMMPPPPMGMMPPPPPPPSGQPPPPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLPW QQRSLPAAAMARAMRVRTFRAHW |
| Applications : | ELISA; WB-Re; AP; Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | SF1 splicing factor 1 [ Homo sapiens ] |
| Official Symbol | SF1 |
| Synonyms | SF1; splicing factor 1; zinc finger protein 162 , ZNF162; ZFM1; zinc finger protein 162; transcription factor ZFM1; zinc finger gene in MEN1 locus; mammalian branch point-binding protein; BBP; MBBP; ZNF162; D11S636 |
| Gene ID | 7536 |
| mRNA Refseq | NM_201997 |
| Protein Refseq | NP_973726 |
| MIM | 601516 |
| UniProt ID | Q15637 |
| Chromosome Location | 11q13 |
| Function | RNA binding; poly(A) RNA binding; transcription corepressor activity; zinc ion binding |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SF1 Products
Required fields are marked with *
My Review for All SF1 Products
Required fields are marked with *



