Recombinant Full Length Human SF1 Protein, C-Myc/DDK-tagged
Cat.No. : | SF1-24HFL |
Product Overview : | Recombinant Full Length Human SF1 Protein, fused to Myc/DDK-tag at C-terminus, was expressed in HEK293T. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a nuclear pre-mRNA splicing factor. The encoded protein specifically recognizes the intron branch point sequence at the 3' splice site, together with the large subunit of U2 auxiliary factor (U2AF), and is required for the early stages of spliceosome assembly. It also plays a role in nuclear pre-mRNA retention and transcriptional repression. The encoded protein contains an N-terminal U2AF ligand motif, a central hnRNP K homology motif and quaking 2 region which bind a key branch-site adenosine within the branch point sequence, a zinc knuckles domain, and a C-terminal proline-rich domain. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol. |
Molecular Mass : | 59.5 kDa |
AA Sequence : | MATGANATPLDFPSKKRKRSRWNQDTMEQKTVIPGMPTVIPPGLTREQERAYIVQLQIEDLTRKLRTGDL GIPPNPEDRSPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDKV MIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTAN TMENVKKAVEQIRNILKQGIETPEDQNDLRKMQLRELARLNGTLREDDNRILRPWQSSETRSITNTTVCT KCGGAGHIASDCKFQRPGDPQSAQDKARMDKEYLSLMAELGEAPVPASVGSTSGPATTPLASAPRPAAPA NNPPPPSLMSTTQSRPPWMNSGPSESRPYHGMHGGGPGGPGGGPHSFPHPLPSLTGGHGGHPMQHNPNGP PPPWMQPPPPPMNQGPHPPGHHGPPPMDQYLGSTPVGSGVYRLHQGKGMMPPPPMGMMPPPPPPPSGQPP PPPSGPLPPWQQQQQQPPPPPPPSSSMASSTPLPWQQRSLPAAAMARAMRVRTFRAHW myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Notes : | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Full Length : | Full L. |
Gene Name | SF1 splicing factor 1 [ Homo sapiens (human) ] |
Official Symbol | SF1 |
Synonyms | BBP; MBBP; ZFM1; ZNF162; D11S636; ZCCHC25 |
Gene ID | 7536 |
mRNA Refseq | NM_201998.3 |
Protein Refseq | NP_973727.1 |
MIM | 601516 |
UniProt ID | Q15637 |
◆ Recombinant Proteins | ||
SF1-2610H | Recombinant Human SF1, GST-tagged | +Inquiry |
SF1-1707H | Recombinant Human SF1 protein, His & T7-tagged | +Inquiry |
SF1-11929Z | Recombinant Zebrafish SF1 | +Inquiry |
SF1-2609H | Recombinant Human SF1, GST-tagged | +Inquiry |
Sf1-5807M | Recombinant Mouse Sf1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SF1-1922HCL | Recombinant Human SF1 293 Cell Lysate | +Inquiry |
SF1-1921HCL | Recombinant Human SF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SF1 Products
Required fields are marked with *
My Review for All SF1 Products
Required fields are marked with *
0
Inquiry Basket