"CTGF" Related Products

Expand
Expand

Recombinant Human CTGF, Fc-tagged

Cat.No.: CTGF-2606H
Product Overview: Recombinant Human CTGF is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln27-Ala349 ) of Human CTGF fused with a FC tag at the C-terminus.
Description: The protein encoded by this gene is a mitogen that is secreted by vascular endothelial cells. The encoded protein plays a role in chondrocyte proliferation and differentiation, cell adhesion in many cell types, and is related to platelet-derived growth factor. Certain polymorphisms in this gene have been linked with a higher incidence of systemic sclerosis.
Source: human cells
Species: Human
Tag: Fc
Form: Lyophilized from a 0.2 μM filtered solution of PBS,pH 7.4
AA Sequence: QNCSGPCRCPDEPAPRCPAGVSLVLDGCGCCRVCAKQLGELCTERDPCDPHKGLFCDFGSPANRK IGVCTAKDGAPCIFGGTVYRSGESFQSSCKYQCTCLDGAVGCMPLCSMDVRLPSPDCPFPRRVKL PGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMGISTRV TNDNASCRLEKQSRLCMVRPCEADLEENIKKGKKCIRTPKISKPIKFELSGCTSMKTYRAKFCGV CTDGRCCTPHRTTTLPVEFKCPDGEVMKKNMMFIKTCACHYNCPGDNDIFESLYYRKMYGDMAVD DIEGRMDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEV KFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISK AKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS FFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin: Less than 0.1 ng/µg (1 IEU/µg).
Purity: Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Shipping: The product is shipped at ambient temperature.
Gene Name: CTGF connective tissue growth factor [ Homo sapiens ]
Official Symbol: CTGF
Synonyms: CTGF; connective tissue growth factor; IGFBP8, CCN2; NOV2; HCS24; MGC102839; hypertrophic chondrocyte-specific protein 24; insulin-like growth factor-binding protein 8; OTTHUMP00000017213; Hypertrophic chondrocyte-specific protein 24
Gene ID: 1490
mRNA Refseq: NM_001901
Protein Refseq: NP_001892
MIM: 121009
UniProt ID: P29279
Chromosome Location: 6q23.1
Pathway: Fatty acid, triacylglycerol, and ketone body metabolism; Hippo signaling pathway; PPARA activates gene expression
Function: growth factor activity; heparin binding; insulin-like growth factor binding; integrin binding; protein binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.