"FASN" Related Products

Expand
Expand
Expand

Recombinant Human FASN, GST-tagged

Cat.No.: FASN-21H
Product Overview: Recombinant Human FASN(2378 a.a. - 2477 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description: The enzyme encoded by this gene is a multifunctional protein. Its main function is to catalyze the synthesis of palmitate from acetyl-CoA and malonyl-CoA, in the presence of NADPH, into long-chain saturated fatty acids. In some cancer cell lines, this protein has been found to be fused with estrogen receptor-alpha (ER-alpha), in which the N-terminus of FAS is fused in-frame with the C-terminus of ER-alpha.
Source: Wheat germ
Species: Human
Tag: GST
Molecular Mass: 36.74 kDa
AA Sequence: MEHNRVLEALLPLKGLEERVAAAVDLIIKSHQGLDRQELSFAARSFYYKLRAAEQYTPKAKYHGNVMLLRAKTGG AYGEDLGADYNLSQVCDGKVSVHVI
Applications: ELISA; WB-Re; AP; Array
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name: FASN fatty acid synthase [ Homo sapiens ]
Official Symbol: FASN
Synonyms: FASN; fatty acid synthase; FAS; SDR27X1; short chain dehydrogenase/reductase family 27X; member 1;
Gene ID: 2194
mRNA Refseq: NM_004104
Protein Refseq: NP_004095
MIM: 600212
UniProt ID: P49327
Chromosome Location: 17q25
Pathway: AMPK signaling; Activation of gene expression by SREBF (SREBP); Defective AMN causes hereditary megaloblastic anemia 1
Function: 3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase activity; 3-oxoacyl-[acyl-carrier-protein] synthase activity; [acyl-carrier-protein] S-acetyltransferase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.